Search by BoMiProt ID - Bomi7027


Primary Information

BoMiProt ID Bomi7027
Protein Name Mesencephalic astrocyte-derived neurotrophic factor/Arginine-rich protein/Protein ARMET
Organism Bos taurus
Uniprot IdP80513
Milk FractionWhey
Ref Sequence Id NP_001094681.1
Aminoacid Length 179
Molecular Weight 20357
Fasta Sequence https://www.uniprot.org/uniprot/P80513.fasta
Gene Name MANF
Gene Id 540432
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells spermatocyte
Protein Function Mesencephalic astrocyte-derived neurotrophic factor (MANF) is an ER stress-inducible secretion protein that inhibits inflammation by interacting with the key subunit of nuclear factor kappa light chain enhancer of activated B cells (NF-κB) p65.
PTMs Disulfide bond formation, Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P80513|MANF_BOVIN Mesencephalic astrocyte-derived neurotrophic factor OS=Bos taurus OX=9913 GN=MANF PE=1 SV=2 MWATHGLAVALALSVLPASRALRQGDCEVCISYLGRFYQDLKDRDVTFSPASIEKELIKF CREARGKENRLCY*73YIGATEDAATKIINEVSKPLSHHIPVEKICEKLKKKDSQICELKYDK QIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASSRTDL
Predicted Disorder Regions 98-116, 125-133, 168-179
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Liu J, Wu Z, Han D, Wei C, Liang Y, Jiang T, Chen L, Sha M, Cao Y, Huang F, Geng X, Yu J, Shen Y, Wang H, Feng L, Wang D, Fang S, Wang S, Shen Y. Mesencephalic Astrocyte-Derived Neurotrophic Factor Inhibits Liver Cancer Through Small Ubiquitin-Related Modifier (SUMO)ylation-Related Suppression of NF-κB/Snail Signaling Pathway and Epithelial-Mesenchymal Transition. Hepatology. 2020 Apr;71(4):1262-1278. doi: 10.1002/hep.30917. Epub 2020 Jan 26. PMID: 31469428; PMCID: PMC7187412.