Search by BoMiProt ID - Bomi7024


Primary Information

BoMiProt ID Bomi7024
Protein Name Menin
Organism Bos taurus
Uniprot IdQ0P5I0
Milk FractionWhey
Ref Sequence Id NP_001069629.1
Aminoacid Length 610
Molecular Weight 67384
Fasta Sequence https://www.uniprot.org/uniprot/Q0P5I0.fasta
Gene Name MEN1
Gene Id 539431
Protein Existence Status reviewed

Secondary Information

Protein Function ubiquitously expressed in all tissues examined, including bone.It is related to various cellular functions, such as transcriptional regulation, DNA replication, DNA repair, cell cycle and cell differentiationacts as tumor suppressor.Menin is considered to support BMP-2- and Runx2-induced differentiation of mesenchymal cells into osteoblasts by interacting with Smad1/5, Runx2, β-catenin and LEF-1.
Biochemical Properties 610-amino-acid protein,two nuclear localization signal sequences are identified at the carboxyl-terminal portion of this protein.Also contains two leucine zipper-like motifs (LZM).menin is required for adipocyte differentiation by augmenting peroxisome proliferator-activated receptor gamma (PPARγ) target gene expression through recruitment of H3K4 methyltransferase activity.
Significance in milk regulates milk protein synthesis through mTOR signaling in mammary epithelial cells
PTMs Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0P5I0|MEN1_BOVIN Menin OS=Bos taurus OX=9913 GN=MEN1 PE=2 SV=1 MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPE LTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKK VSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSED HAWVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMV CAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLT LYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNYCREDEEI YKEFFEVANDVIPNLLKEAASLLEAGEERPGEQTQGTQSQGSALQDPECFAHLLRFYDGI CKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRR RGPRRES*487KPEEPPPPKKPALDKGPGAGQGAVPGPPRKPPGTVPGTARGAEGGSAAPVPAP AAS*543PPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVST*594PSDYTL SFLKRQRKGL
Predicted Disorder Regions 65-69, 199-206, 385-403, 476-488, 529-554, 566-601
DisProt Annotation
TM Helix Prediction no TM helices
Significance of PTMs menin is specifically phosphorylated at Ser394 in response to several forms of DNA damage.Ser487 is dynamically phosphorylated and Ser543 is constitutively phosphorylated.
Bibliography 1.Kaji H. Menin and bone metabolism. J Bone Miner Metab. 2012 Jul;30(4):381-7. doi: 10.1007/s00774-012-0355-3. Epub 2012 Apr 28. PMID: 22543820. 2.Francis J, Lin W, Rozenblatt-Rosen O, Meyerson M. The menin tumor suppressor protein is phosphorylated in response to DNA damage. PLoS One. 2011 Jan 14;6(1):e16119. doi: 10.1371/journal.pone.0016119. PMID: 21264250; PMCID: PMC3021530.