Search by BoMiProt ID - Bomi7019


Primary Information

BoMiProt ID Bomi7019
Protein Name Membrane protein FAM174B
Organism Bos taurus
Uniprot IdQ1RMK9
Milk FractionWhey
Ref Sequence Id NP_001069818.1
Aminoacid Length 159
Molecular Weight 16654
Fasta Sequence https://www.uniprot.org/uniprot/Q1RMK9.fasta
Gene Name FAM174B
Gene Id 614841
Protein Existence Status reviewed

Secondary Information

Protein Function  Golgi structural integrity
PTMs N-linked glycosylation on asparagine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1RMK9|F174B_BOVIN Membrane protein FAM174B OS=Bos taurus OX=9913 GN=FAM174B PE=2 SV=1 MRAALPPARLLPLLLLLALLGAPAARASRAQSAAPPQPGAERQPRPPPGPGPGN*54ATGTGS GEAAGGGGSSNSSGDALVTRISSLLRDLHTLKAAVIVACAFTAFLIACLLLRVFRSGKRL KKTRKYDIITTPAERVEMAPLNEEDDEDEDSTVFDIKYR
Predicted Disorder Regions 4 disordered segments; (1-8), (11-15),( 21-77), (117-159)
DisProt Annotation
TM Helix Prediction 2TMHs; (7-25) and (93-115)