Search by BoMiProt ID - Bomi7008


Primary Information

BoMiProt ID Bomi7008
Protein Name Melanocyte protein PMEL
Organism Bos taurus
Uniprot IdQ06154
Milk FractionWhey
Ref Sequence Id NP_001073684.2
Aminoacid Length 649
Molecular Weight 69366
Fasta Sequence https://www.uniprot.org/uniprot/Q06154.fasta
Gene Name PMEL
Gene Id 281487
Protein Existence Status reviewed

Secondary Information

Protein Function fibril formation within melanosomes during vertebrate melanogenesis. PMEL mutations were also found to alter pheomelanic pigmentation resulting in coat color dilution.
Significance in milk melanogenesis
PTMs N and O Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q06154|PMEL_BOVIN Melanocyte protein PMEL OS=Bos taurus OX=9913 GN=PMEL PE=2 SV=2 MDLVLRKYLLHVALMGVLLAVGTTEGPRDRDWLGVSRQLRIKAWNRQLYPEWTESQGPDC WRGGHISLKVSNDGPTLIGAN*81ASFSIALHFPKSQKVLPDGQVIWAN*106NTIIN*111GSQVWGGQL VYPQEPDDTCIFPDGEPCPSGPLSQKRCFVYVWKTWDQYWQVLGGPVSGLSIGTDKAMLG TYNMEVTVYHRRGSQSYVPLAHSSSAFTITDQVPFSVSVSQLQALDGRNKRFLRKQPLTF ALQLHDPSGYLAGADLSYTWDFGDSTGTLISRALTVTHTYLESGPVTAQVVLQAAIPLTS CGSSPVPGTTDRHVTTAEAPGTTAGQVPTTEVMGTTPGQVPTAEAPGTTVGWVPTTEDVG TTPEQVATSKVLSTTPVEMPTAKATGRTPEVSTREPSGTTVTQGTTPELVETTAGEVSTP EPAGSN*426TSSFMPTEGTAGSLSPLPDDTATLVLEKRQAPLDCVLYRYGSFSLTLDIVQGIE SAEILQAVSSSEGDAFELTVSCQGGLPKEACMDISSPGCQLPAQRLCQPVPPSPACQLVL HQVLKGGSGTYCLN554VSLADANSLAMVSTQLVMPGQEAGLRQAPLFVGILLVLTALLLASL IYRRRLMKQGSAVPLPQLPHGRTQWLRLPWVFRSCPIGESKPLLSGQQV
Predicted Disorder Regions 1 disordered segment; (295-453)
DisProt Annotation
TM Helix Prediction 1TMH ; (584-602)
Bibliography Knaust J, Weikard R, Albrecht E, Brunner RM, Günther J, Kühn C. Indication of Premelanosome Protein (PMEL) Expression Outside of Pigmented Bovine Skin Suggests Functions Beyond Eumelanogenesis. Genes (Basel). 2020 Jul 13;11(7):788. doi: 10.3390/genes11070788. PMID: 32668786; PMCID: PMC7397160.