Search by BoMiProt ID - Bomi7002


Primary Information

BoMiProt ID Bomi7002
Protein Name Meiosis regulator and mRNA stability factor 1/Limkain-b1/
Organism Bos taurus
Uniprot IdE1BP74
Milk FractionWhey
Aminoacid Length 1742
Molecular Weight 192127
Fasta Sequence https://www.uniprot.org/uniprot/E1BP74.fasta
Gene Name MARF1/LKAP
Protein Existence Status reviewed

Secondary Information

Protein Function A novel autoantigen that co-localizes with a subset of cytoplasmic microbodies.
Biochemical Properties Tandem RNA-binding domain motifs (RRM, RPN-1) at amino acids 514–580 and 784–856 are present in LKAP
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|E1BP74|MARF1_BOVIN Meiosis regulator and mRNA stability factor 1 OS=Bos taurus OX=9913 GN=MARF1 PE=3 SV=2 MEGSGTENPCSTTVGWLQQDNDAKPWLWRFSNCFSRPQQTLPLSPQTKDYMENKKVAVEL KDVPS*65PLHAGSKLFPAVPLPDIHSLQQPKVQLSTVPKVSCCAHCTNDPSTSPVRFGGGSG GGAGSLVPPGALLDSQSTRTITCQVGSGLAFQSAPPLQNASARNTLAGVASDFPSMCLES NLSSCKHLPCCGKLHFQSCRGNVHKLHQFPALQGCPSSAGYFPCSDFTSGAPGHVEEHVS QSELTPHLCTNSLHLNVVPPVCLKGSLYCEDCLSKPARNSIIDAAKVWPNIPPPNTQTAP VTVPLCNGCGTKGMGKETTLLLATSLGKAASKFGSPEVALAGQMLENLPPIGVFWDIENC SVPSGRSATAVVQRIREKFFKGHREAEFICVCDISKENKEVIQELNNCQVTVAHINATAK NAADDKLRQSLRRFANTHTAPATVVLVSTDVNFALELSDLRHRHGFHIILVHKNQASEAL LHHANELIRFEEFISDLPPRLPLKMPCHTLLYVYNLPANKDGKSISNRLRRLSDNCGGKV LNITGCSAILRFINRDSAERALKRMENEDVFGNRIVVSFTPKSSELCETKSSNATADKVK SPKKLKNPKLCLIKDISESPSSAKAAPGKGSQANSGSATRNANVKSLQELCRLESKTGTR SSEPQQGHLRLGAPPHRSSSAAAPAPKAPGLAESVY*696KTNPKKESLGARSVTSSPVEKKEK EETLFQVSYPSAFSKLIASRQVSPLLTAQPWSSRNLS*757PNLLNRASPLAFNAAHSSVGADG PDPFAHGVDVQISNLDYRLSRKELQQLMQEAFSRHGKVKSVELSPHTDYQLKAVVQMENL QEAIGAVNSLHRYKIGSKKILVSLATGAANKSLSLLSAETMSILQDAPACCLPLFKFTDI YEKKFGHRLNVSDLYKLTDTVAIREQGNGRLVCLLPSSQARQSPLGSSQSHDGSSTNCSP IIFEELEYHEPVCRQHCPNKDFSEHEFDPDSYKIPFVILSLKTFAPQVHSLLQTHEGTVP LLSFPDCYAAEFGELEIVQENRGGGVPLEHLITCVPGVNIATAQNGVKVVKWIHNKPPPP NTDPWLLRS*1089KS*1091PVGNPQLIQFSREVIDLLKNQPSCVIPISNFIPSYHHHFAKQCRVSDYG YSKLIELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQASKQVIVKEFAQ AYHWCFSKDWDVTEYGVCELIDIISEIPDTTICLSQQDSEAMICIPRRERTQDEIERTKQ FSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLELFEAIPDILQVLEC GEEKILTLTEVERFKALAAQFVKLLRSQKDNCLMMTDLLKEYAKTFGYTFRLQDYDVSSV SALTQKLCHVVKVADMESGKQIQLINRKSLRALTAQLLVLLMSWEGTTHLSVDELKRHYE STHSTPLNPCEYGFMTLTELLKSLPYLVEDQVFTNDKTEECVKLTSLYLFAKNVRSLLHT YHYQQLFLHEFSMAYSKYVGETLQPKTYGFSSVEELLGAIPQVVWIKGHGHKRIVVLKND MKSRVNSLGPS*1571PASHETQPSAPERILEVPESPPASELRLGVGGDGPHPAEQELLRLTDDS PVDLLCAPVPSCLPSPQLRPDPVVLQAADLIWFEEHPQEPSEIMILNQEEKIEIPVPIRN ENLPPDPSSPGVSAAVPAPPSPSSETPESLLSKDPTESPAKKQPKNRVKLAANFSFAPIT KL
Predicted Disorder Regions 1600-1704
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Many proteins that localize to peroxisomes contain a conserved targeting signal (MICROBODIES_CTR) in the last three amino acids in the carboxyl terminus. The LKAP carboxyl terminus sequence TKL (Thr-Lys-Leu) fits the MICROBODIES_CTR consensus sequence.
Bibliography 1.Dunster K, Lai FP, Sentry JW. Limkain b1, a novel human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Clin Exp Immunol. 2005 Jun;140(3):556-63. doi: 10.1111/j.1365-2249.2005.02774.x. PMID: 15932519; PMCID: PMC1809386. 2.Gould SJ, Keller GA, Schneider M et al. Peroxisomal protein import is conserved between yeast, plants, insects and mammals. EMBO J 1990; 9:85–90.