Search by BoMiProt ID - Bomi6974


Primary Information

BoMiProt ID Bomi6974
Protein Name Matrix Gla protein
Organism Bos taurus
Uniprot IdP07507
Milk FractionWhey,Casein
Ref Sequence Id NP_777132.1
Aminoacid Length 103
Molecular Weight 12217
Fasta Sequence https://www.uniprot.org/uniprot/P07507.fasta
Gene Name MGP
Gene Id 282660
Protein Existence Status reviewed

Secondary Information

Protein Function MGP is considered to be a marker of vitamin K status in bone and vasculature.Matrix Gla protein (MGP), belongs to the vitamin K dependent protein family, which is comprised of both hepatic and extrahepatic proteins.Associates with the organic matrix of bone and cartilage. Matrix Gla protein is a vitamin K-dependent protein secreted by chondrocytes and vascular smooth muscle cells. inhibitory role of physiological and ectopic calcification.
Biochemical Properties 84 amino acid residues and 5 Gla(r γ-carboxyglutamic acid) residues.The activity is mainly due to the high affinity of their γ-carboxyglutamic acid (Gla) residues for calcium ions. These residues are the result of γ-carboxylation of glutamic acid, a reaction catalyzed by γ-glutamyl carboxylase, in which vitamin K acts as a cofactor.A phosphorylation domain, in the N-terminal end of the signal peptide, contains 3 phosphorylated serine residues.A single, disulfide bond is observed between two conserved cysteines.The N-terminal end also includes the target site for γ-glutamyl carboxylase. Bovine matrix Gla protein is of 79-residue long,contains a single disulfide bond and 4.8 gamma-carboxyglutamate (Gla) residues, one each at positions 37, 41, 48, and 52, and 0.8 Gla and 0.2 Glu at position 2.
Significance in milk Bovine bone growth
PTMs Disulfide bond.phosphorylation and γ-carboxylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P07507|MGP_BOVIN Matrix Gla protein OS=Bos taurus OX=9913 GN=MGP PE=1 SV=1 MKSLLLLSILAALAVAALCYES*22HES*25LES*28YEINPFINRRNANSFISPQQRWRAKAQERIRE LNKPQYELNREACDDFKLCERYAMVYGYNAAYDRYFRQRRGAK
Predicted Disorder Regions 5 predicted disordered segments; (1-5), (31-49), (54-63), (85-87), (92-103)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs MGPs undergo reactions of phosphorylation and γ-carboxylation for the sole purpose of binding calcium ions and inhibiting calcification.There is Conserved phosphorylation of serines in the Ser-X-Glu/Ser(P) sequences of the vitamin K-dependent matrix Gla protein from shark, lamb, rat, cow, and human.
Additional Comments Due to sequence homology,MGP and bone Gla protein (BGP) to indicate that these two bovine bone proteins arose by gene duplication and subsequent divergent evolution. Although MGP has a very low solubility in water compared to BGP, there is no hydrophobic domain in MGP which could account for its insolubility, and the overall fraction of hydrophobic residues is 32% for MGP compared to 43% for BGP.
Bibliography 1.Price PA, Williamson MK. Primary structure of bovine matrix Gla protein, a new vitamin K-dependent bone protein. J Biol Chem. 1985 Dec 5;260(28):14971-5. PMID: 3877721. 2.Gheorghe SR, Crăciun AM. Matrix Gla protein in tumoral pathology. Clujul Med. 2016;89(3):319-21. doi: 10.15386/cjmed-579. Epub 2016 Jul 28. PMID: 27547048; PMCID: PMC4990424. 3.Price PA, Rice JS, Williamson MK. Conserved phosphorylation of serines in the Ser-X-Glu/Ser(P) sequences of the vitamin K-dependent matrix Gla protein from shark, lamb, rat, cow, and human. Protein Sci. 1994 May;3(5):822-30. doi: 10.1002/pro.5560030511. PMID: 8061611; PMCID: PMC2142713.