Search by BoMiProt ID - Bomi6967


Primary Information

BoMiProt ID Bomi6967
Protein Name Mastermind-like protein 2
Organism Bos taurus
Uniprot IdA5D7F6
Milk FractionWhey
Ref Sequence Id NP_001091519.1
Aminoacid Length 1128
Molecular Weight 120886
Fasta Sequence https://www.uniprot.org/uniprot/A5D7F6.fasta
Gene Name MAML2
Gene Id 521194
Protein Existence Status reviewed

Secondary Information

Protein Function a transcriptional coactivator for NOTCH proteins.Binding of MAML proteins to the ICN–CSL complex is essential for NOTCH-mediated transcriptional activation
Biochemical Properties contain an N-terminal region of approximately 60 amino acids (AA) that binds an extended groove formed by CSL and the ankyrin–domain of ICN. C-terminal domain is required for transcriptional activation
PTMs phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A5D7F6|MAML2_BOVIN Mastermind-like protein 2 OS=Bos taurus OX=9913 GN=MAML2 PE=2 SV=1 MGDTAPPQAPTGGLGGAPGAGLLGGGSVTPRVHSAIVERLRARIAVCRQHHLSCEGRYER GRAESSDRERESTLQLLSLVQHGQGARKAGKHTKATASTATATAPPPAPAAPPTASQTAA PAAPAPPPDYHHHHQQHLRSSSSSGGSGGIDGEQQQQPPASTPGDQRNSALIALQGS*177LKR KQIVNLSPANSKRPNGFVDNSFLDIKRIRVGENLAAGPGGLPVNNGQSQMMSGTLPMSQV PLRKTAALPPPPTHSPGNGLFNMGLKEVKKEPGETLSCSKHVDGQVTQENIFSNRYGDDP GEQLMDPELQELFNELTNISVPPMSDLELENMINATIKQDDPFNIDLGQQSQRSTPRPSL PLEKTVIKSEYSPGLTQGPSGSPQLRPSSAGPAFSMASSGLSASSPIPSVPQSQAQPPPA TGAARALPSWQEVSHAQQLKQIAANRQQHVRMHQQQQQHQPTSWPALPSSAGPSPGPFGQ EKIPSPSFGQQPFSPQSTPMPGVTGGSNQSKVMANYLFKASPSAQGGPLDVLLQPKPQDL SRSFLNNPHPAMEPRHGSTKPLFHFNSDQANQQMPSVLPSQSKPSLLHYTQQQPQQSSIT VQPQQQQQQPQQQQQPQQQQQPQPQQQQQQQPQAQQPAAQPTQPLSNQPLLRAPLPLQQK ILLQKIQNQPITGLGYQVSQQHRQDQHSVVGQNAGPSPSPNPCSNPNTGSGYMNSQQSLL NQQLMGKKQTLQRQIMEQKQQLLLQQQMLADAEKIAPQDQINRHLTRPPPDYKDQRRNVG NMQPTAQYSGGSSTVSLNSNQALANPVSTHTILTPNSSLMSTSHGTRMPSLPTAVQNIGI YGNLPCSQPSTYSVTSGMNQLTQPRNPNQLIANQNNPLMPRPPTLGPSNNNNNNVATFGA GSVGNSQQLRPNLTHSMASMPAQRTSNVMITSNTATPNWASQEATAKQQEALKSAGVRFP TGTTTAYAPNQSLQQAVGSQQFSQRAVAPSNQLTPAVQMRPMNQMSQTLNGQNMGPLRSL NLRPNQLSTQLLPTMNQAGTGLSQSRTVSQPPSLAAGGFPSPNQSSRAFQGTDHGNDLAF DFLNQQTDNMGPALNSDADFIDSLLKTEPGNDDWMKDINLDEILGNNS
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Köchert K, Ullrich K, Kreher S, Aster JC, Kitagawa M, Jöhrens K, Anagnostopoulos I, Jundt F, Lamprecht B, Zimber-Strobl U, Stein H, Janz M, Dörken B, Mathas S. High-level expression of Mastermind-like 2 contributes to aberrant activation of the NOTCH signaling pathway in human lymphomas. Oncogene. 2011 Apr 14;30(15):1831-40. doi: 10.1038/onc.2010.544. Epub 2010 Nov 29. PMID: 21119597.