Search by BoMiProt ID - Bomi6952


Primary Information

BoMiProt ID Bomi6952
Protein Name Mannose-6-phosphate isomerase/Phosphohexomutase/Phosphomannose isomerase
Organism Bos taurus
Uniprot IdQ3SZI0
Milk FractionExosomes
Ref Sequence Id NP_001030361.1
Aminoacid Length 423
Molecular Weight 46369
Fasta Sequence https://www.uniprot.org/uniprot/Q3SZI0.fasta
Gene Name MPI
Gene Id 513586
Protein Existence Status Reviewed

Secondary Information

Protein Function PMI expression acts as a potential biomarker to predict the prognosis of PDAC.
PTMs Phosphorylation at Ser,N-acetylation at Ala
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SZI0|MPI_BOVIN Mannose-6-phosphate isomerase OS=Bos taurus OX=9913 GN=MPI PE=2 SV=3 MAAQRVFPLSCVVQQYAWGKMGSNSEVARLLASSDPLAQISEDRPYAELWMGTHPRGDAK ILDNRISQKTLGQWIADNQDSLGSKVKDTFNGKLPFLFKVLS*102VETALS*108IQAHPNKELAEK LHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLTKVPEFQFLIGDNAAAQLK QSLSQDSEAVTSALRSCFSHLMKSEKKVVVEQLNLLVKRISQQVAAGNNMEDICGELLLQ LHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTP KFIDVPTLCEMLSYTPSPSQDRLFPPARSPEDPYLSIYDPPVPDFTVMKVEVPGSVTEYK VLALDSASILLVVQGTVTASSPTAQAAIPLKRGGVLFIGANESVSLKLTVPKDLLMFRAC CLL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Alipour Z, Agostini-Vulaj D, Findeis-Hosey J, Liu L, Gonzalez RS, Drage MG, Krigman H, Zhou Z. Phosphomannose Isomerase High Expression Associated with Better Prognosis in Pancreatic Ductal Adenocarcinoma. Clin Exp Gastroenterol. 2021 Sep 1;14:353-360. doi: 10.2147/CEG.S316492. PMID: 34511962; PMCID: PMC8421669.