Search by BoMiProt ID - Bomi6919


Primary Information

BoMiProt ID Bomi6919
Protein Name Macrophage scavenger receptor types I and II/Macrophage acetylated LDL receptor I and II/CD_antigen: CD204
Organism Bos taurus
Uniprot IdP21758
Milk FractionWhey,MFGM
Ref Sequence Id NP_001106711.1
Aminoacid Length 453
Molecular Weight 50057
Fasta Sequence https://www.uniprot.org/uniprot/P21758.fasta
Gene Name MSR1
Gene Id 281311
Protein Existence Status reviewed

Secondary Information

Protein Function MSR1 is a multifunctional phagocytic receptor, highly expressed in macrophages, involved in uptake of apoptotic cells and modified lipoproteins.Membrane glycoproteins implicated in the pathologic deposition of cholesterol in arterial walls during atherogenesis.
PTMs Ubl conjugation,Disulfide bond formation, Glycosylation, Phosphorylation
Significance of PTMs The recruitment of TAK1/MKK7/JNK signalling complex is mediated through K63 polyubiquitylation of the macrophage scavenger receptor 1 (MSR1). K63 polyubiquitylation on phagosomal proteins is also used as a scaffold for the recruitment of signalling complexes,in particular the kinase complex TAK1/MKK7/JNK to MSR1 via specific polyubiquitylation on a conserved lysine K27.
Linking IDs Bomi6919
Bibliography Guo M, Härtlova A, Gierliński M, Prescott A, Castellvi J, Losa JH, Petersen SK, Wenzel UA, Dill BD, Emmerich CH, Ramon Y Cajal S, Russell DG, Trost M. Triggering MSR1 promotes JNK-mediated inflammation in IL-4-activated macrophages. EMBO J. 2019 Jun 3;38(11):e100299. doi: 10.15252/embj.2018100299. Epub 2019 Apr 26. PMID: 31028084; PMCID: PMC6545745.
Protein Function MSR1 is a multifunctional phagocytic receptor, highly expressed in macrophages, involved in uptake of apoptotic cells and modified lipoproteins.Membrane glycoproteins implicated in the pathologic deposition of cholesterol in arterial walls during atherogenesis.
PTMs Ubl conjugation,Disulfide bond formation, Glycosylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P21758|MSRE_BOVIN Macrophage scavenger receptor types I and II OS=Bos taurus OX=9913 GN=MSR1 PE=1 SV=1 MAQWDDFPDQQEDTDSCTESVKFDARSVTALLPPHPKNGPTLQERMKSYKTALITLYLIV FVVLVPIIGIVAAQLLKWETKN*82CTVGSVNADISPSPEGKGN*101GSEDEMRFREAVMERMSNM ESRIQYLSDNEANLLDAKNFQN*142FSITTDQRFNDVLFQLNSLLSSIQEHENIIGDISKSLV GLN*183TTVLDLQFSIETLNGRVQENAFKQQEEMRKLEERIYN*220ASAEIKSLDEKQVYLEQEIK GEMKLLNN*248ITNDLRLKDWEHSQTLKN*266ITLLQGPPGPPGEKGDRGPPGQNGIPGFPGLIGT PGLKGDRGISGLPGVRGFPGPMGKTGKPGLNGQKGQKGEKGSGSMQRQSNTVRLVGGSGP HEGRVEIFHEGQWGTVCDDRWELRGGLVVCRSLGYKGVQSVHKRAYFGKGTGPIWLNEVF CFGKESSIEECRIRQWGVRACSHDEDAGVTCTT
Predicted Disorder Regions 1-20, 35-44, 93-104, 226-232, 268-313, 333-337, 352-355
DisProt Annotation Disorder content 11%
Term disorder, Fragment 1 - 50
Term protein binding , Fragment 1 - 50
Term molecular sequestering activity, Fragment 1 - 50
TM Helix Prediction 1TMH; (53-75)
Significance of PTMs The recruitment of TAK1/MKK7/JNK signalling complex is mediated through K63 polyubiquitylation of the macrophage scavenger receptor 1 (MSR1). K63 polyubiquitylation on phagosomal proteins is also used as a scaffold for the recruitment of signalling complexes,in particular the kinase complex TAK1/MKK7/JNK to MSR1 via specific polyubiquitylation on a conserved lysine K27.
Linking IDs
Bibliography Guo M, Härtlova A, Gierliński M, Prescott A, Castellvi J, Losa JH, Petersen SK, Wenzel UA, Dill BD, Emmerich CH, Ramon Y Cajal S, Russell DG, Trost M. Triggering MSR1 promotes JNK-mediated inflammation in IL-4-activated macrophages. EMBO J. 2019 Jun 3;38(11):e100299. doi: 10.15252/embj.2018100299. Epub 2019 Apr 26. PMID: 31028084; PMCID: PMC6545745.