Search by BoMiProt ID - Bomi6916


Primary Information

BoMiProt ID Bomi6916
Protein Name Lysyl oxidase homolog 2/Lysyl oxidase-like protein 2
Organism Bos taurus
Uniprot IdA6H737
Milk FractionWhey
Ref Sequence Id NP_001092523.1
Aminoacid Length 774
Molecular Weight 86785
Fasta Sequence https://www.uniprot.org/uniprot/A6H737.fasta
Gene Name LOXL2
Gene Id 532684
Protein Existence Status reviewed

Secondary Information

Protein Function ritical to tumor microenvironment and metastatic niche formation in hepatocellular carcinoma
Biochemical Properties Not only that LOXL2 was regulated by hypoxia/hypoxia-inducible factor 1 alpha (HIF-1α), but also that TGF-β activated LOXL2 transcription through mothers against decapentaplegic homolog 4 (Smad4), whereas two frequently underexpressed miRNA families, miR-26 and miR-29, cooperatively suppressed LOXL2 transcription through interacting with the 3' untranslated region of LOXL2.
Significance in milk Ordered Collagen Fibrillogenesis
PTMs Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6H737|LOXL2_BOVIN Lysyl oxidase homolog 2 OS=Bos taurus OX=9913 GN=LOXL2 PE=2 SV=1 MERRGSSCLCRCLALLALLPTLSLAQYESWRHYPEYFQEPAPEYHRPEVPSDVAKIQLRL AGQKRKHSEGRVEVYYDGQWGTVCDDDFTIHAAHVVCRELGYVEAKSWTASSSYGKGEGP IWLDNVYCTGSEATLAACSSNGWGVTDCKHTEDVGVVCSEKRIPGFKFDNSLINSIENMN IQVEDIRIRAILSAFRKRTPVTEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGEK TYNTKVYKMFAARKKQRYWPYSMDCTGTEAHISSCKLGPQVSLDPVKN*288VTCENGLPAVVS CVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGANVGEGRVEVLKNGEWGTVCDDKWDLVSA SVVCRELGFGSAKEAITGSRLGQGIGPIHLNEIECTGNEKSIIDCKFNAESQGCNHEEDA AVRCNIPAMGFQKKLRLNGGRNPYEGRVEVLVERN*455GSLVWGMVCGENWGIVEAMVVCRQL GLGFASNAFQETWYWHGNINANKVVMSGVKCSGTELSLAHCRHDGEDVACPEGGVRYGAG VACSETAPDLVLNAEIVQQSTYLEDRPMFMLQCAMEENCLSASAAQTNPTTGYRRLLRFS SQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLN*644GTKVAEGHKASFCLED TECEGDIQKSYECANFGEQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNYEV AESDYTNNIMKCRTRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLINNQVSKR
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction no TM helices
Additional Comments Overexpression of LOXL2, an important driver of HCC metastasis.
Bibliography 1.Wong CC, Tse AP, Huang YP, Zhu YT, Chiu DK, Lai RK, Au SL, Kai AK, Lee JM, Wei LL, Tsang FH, Lo RC, Shi J, Zheng YP, Wong CM, Ng IO. Lysyl oxidase-like 2 is critical to tumor microenvironment and metastatic niche formation in hepatocellular carcinoma. Hepatology. 2014 Nov;60(5):1645-58. doi: 10.1002/hep.27320. Epub 2014 Oct 2. PMID: 25048396.