Search by BoMiProt ID - Bomi6914


Primary Information

BoMiProt ID Bomi6914
Protein Name Lysozyme-like protein 1
Organism Bos taurus
Uniprot IdA0JNM6
Milk FractionWhey
Ref Sequence Id NP_001071378.1
Aminoacid Length 148
Molecular Weight 16779
Fasta Sequence https://www.uniprot.org/uniprot/A0JNM6.fasta
Gene Name LYZL1
Gene Id 512087
Protein Existence Status reviewed

Secondary Information

Protein Function lysozyme activity.antibacterial action of LYZL1 is involved bacterial membrane damage and leakage of cellular contents.role in male reproductive tract innate immunity.
Biochemical Properties presence of α-helix, β-sheet and random coil with α-helix .possess peptidoglycan binding ability.Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan.The catalytic mechanism ofmlysozymes involves the interaction of Glu35 and Asp52 of the active site with beta-1,4 glycosidic bond of the substrate.
PTMs Glycosylation and Disulfide bond addition
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A0JNM6|LYZL1_BOVIN Lysozyme-like protein 1 OS=Bos taurus OX=9913 GN=LYZL1 PE=2 SV=1 MKAAGILALMGCLVTVVEPKVYTRCKLAKIFSRASLDNYRGFSLGNWICMAYYESHYN*58TT AQTQLEDGSTDYGIFQINSDTWCRSTKLQEKNRCHVACSALMTDDLTDAIICAKKIVKET DGMNYWQGWKKNCEGRDLSEWKKGCEVS
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction no TM helices
Bibliography Narmadha G, Yenugu S. In Silico and Biochemical Characterization of Lysozyme-Like Proteins in the Rat. PLoS One. 2016 Sep 9;11(9):e0161909. doi: 10.1371/journal.pone.0161909. PMID: 27611690; PMCID: PMC5017655.