Search by BoMiProt ID - Bomi6904


Primary Information

BoMiProt ID Bomi6904
Protein Name Lysine-rich nucleolar protein 1/Testis-specific gene 118 protein
Organism Bos taurus
Uniprot IdA5D7J3
Milk FractionWhey
Ref Sequence Id NP_001160078.1
Aminoacid Length 452
Molecular Weight 51046
Fasta Sequence https://www.uniprot.org/uniprot/A5D7J3.fasta
Gene Name KNOP1/TSG118
Gene Id 511442
Protein Existence Status reviewed

Secondary Information

PTMs Isopeptide bond, Methylation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A5D7J3|KNOP1_BOVIN Lysine-rich nucleolar protein 1 OS=Bos taurus OX=9913 GN=KNOP1 PE=2 SV=2 MITKAHKGEVGLGLPEKKKKKKKVVKEPKTQYSVLNSDNYFAEVCPRATPPLKGVIQEQA PRMPLVKKKKKKKGHSTICEEHLEPEITLRAGRTERSHSPRTQALGLSKSLS*112AEKRKSMS PGSRVKTS*128PDPRQDEEVTRVGKKLKKHKKEKKAKEATAFSGRDPWFCEAGNTVYTHSVGK DGVREQAALGQKQKQGSPREHSVKMKKKKKIHWEGDPPLGHPECSWSLESSPTKGSKKKP VRVEAPEYIPIGDGSRAS*258VKKKVKSKKRVEQADTEEPALKRKKKKKKRQQSEVAEEPWEE EPDT*304DLEVVLEKKGNMDEAHIDQVRRKALQEEIDRESGKTEAYDTKKWTGTQFGQWDTAG FENEEQKLKFLKLMGGFKNLPPSFSRPSPTVARPSMALSKKAADTLQRNLQQDYDRALSW KYSRGAGLGFSTAPAKVFYIDRNASKSIKFED
Predicted Disorder Regions 1-365, 379-401, 448-452
DisProt Annotation
TM Helix Prediction No TM helices