Search by BoMiProt ID - Bomi6890


Primary Information

BoMiProt ID Bomi6890
Protein Name Lymphocyte transmembrane adapter 1/Membrane-associated adapter protein LAX
Organism Bos taurus
Uniprot IdQ58CT8
Milk FractionWhey
Ref Sequence Id NP_001015674.1
Aminoacid Length 387
Molecular Weight 41859
Fasta Sequence https://www.uniprot.org/uniprot/Q58CT8.fasta
Gene Name LAX1
Gene Id 540424
Protein Existence Status reviewed

Secondary Information

Protein Function Negatively regulates T-cell antigen receptor-mediated signaling and B-cell antigen receptor-mediated signaling in T-cell and B-cells respectively.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q58CT8|LAX1_BOVIN Lymphocyte transmembrane adapter 1 OS=Bos taurus OX=9913 GN=LAX1 PE=2 SV=1 MDVTTSAWSETTRRISEPSTLQGTLGSLDKAEDHSSSIFSGFAALLAILLVVAVICVLWC CGKRKKRQVPYLRVTIMPLLTLPRPRQRAKNIYDLLPRRQEELGRHPSRSIRIVSTESLL SRNSDSPSSEHVPSRAGDALHMHRAHTHAMGYAVGIYDNAMRPQMCGNLAPSPHYVNVRA SRGSPSTSSEDSRDY*195VNIPTAKEIAETLASASNPPRNLFILPGTKELAPSEEIDEGCGNA SDCTSLGSPGTENSDPLSDGEGSSQTSNDY*270VNMAELDLGTPQGKQLQGMFQCRRDY*296ENVP PGPSSNKQQEEEVTSSNTDHVEGRTDGPETHTPPAVQSGSFLALKDHVACQSSAHSETGP WEDAEETSSEDSHDY*375ENVCAAEAGARG
Predicted Disorder Regions (1-28), (99-106), (115-141), (178-387)
DisProt Annotation
TM Helix Prediction 1TMH; (38-60)
Significance of PTMs Upon T cell or B cell Recpetor activation, phosphorylation on tyrosines occurs which leads to the recruitment of GRB2, PIK3R1 and GRAP2
Bibliography Harhay, G. P., Sonstegard, T. S., Keele, J. W., Heaton, M. P., Clawson, M. L., Snelling, W. M., Wiedmann, R. T., Van Tassell, C. P., & Smith, T. P. (2005). Characterization of 954 bovine full-CDS cDNA sequences. BMC genomics, 6, 166. https://doi.org/10.1186/1471-2164-6-166