Search by BoMiProt ID - Bomi6886


Primary Information

BoMiProt ID Bomi6886
Protein Name Lymphocyte antigen 96
Organism Bos taurus
Uniprot IdP58754
Milk FractionWhey
Aminoacid Length 160
Molecular Weight 18484
Fasta Sequence https://www.uniprot.org/uniprot/P58754.fasta
Gene Name LY96
Protein Existence Status reviewed

Secondary Information

Protein Function Binds bacterial lipopolysaccharide (LPS).Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria.
Biochemical Properties Heterogeneous homomer formed from homodimers; disulfide-linked .Belongs to the lipopolysaccharide (LPS) receptor, a multi-protein complex containing at least CD14, LY96 and TLR4.
PTMs N linked Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P58754|LY96_BOVIN Lymphocyte antigen 96 OS=Bos taurus OX=9913 GN=LY96 PE=1 SV=1 MFPFMLFSTLFSSIFTEPREKMWICN*26SSDASLWYNYCDDMKFPISVKVEPCVTIKGTKGK LHLYYIARRDIQKLYLNLHISIKSMTLPMRKEVICREYGGDYSFCGALKGETVN*114TTIPFS FQGIRFSPGQYHCVVEAISGNSEEMLFCLN*150FTIIHYSSLN
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Sauter KS, Brcic M, Franchini M, Jungi TW. Stable transduction of bovine TLR4 and bovine MD-2 into LPS-nonresponsive cells and soluble CD14 promote the ability to respond to LPS. Vet Immunol Immunopathol. 2007 Jul 15;118(1-2):92-104. doi: 10.1016/j.vetimm.2007.04.017. Epub 2007 May 3. PMID: 17559944.