Search by BoMiProt ID - Bomi6868


Primary Information

BoMiProt ID Bomi6868
Protein Name Long-chain-fatty-acid--CoA ligase ACSBG1/Acyl-CoA synthetase bubblegum family member 1
Organism Bos taurus
Uniprot IdQ2KHW5
Milk FractionWhey,MFGM
Ref Sequence Id NP_001019719.1
Aminoacid Length 726
Molecular Weight 80585
Fasta Sequence https://www.uniprot.org/uniprot/Q2KHW5.fasta
Gene Name ACSBG1
Gene Id 515577
Protein Existence Status reviewed

Secondary Information

Protein Function A new membrane-associated acyl-CoA synthetase (ACS), termed bubblegum-related protein (BGR), which upon functional analysis demonstrated ACS activity capable of activating long- and very long-chain fatty acids. 
Biochemical Properties BGR cDNA encoding a protein with broad overall homology to the human BGM protein with 50% identical and 68% similar amino acids. The protein exhibits several features of an ACS, namely an AMP-binding motif and a fatty acidbinding motif common to all bubblegum orthologs characterized so far and which exhibits slight homology to known ACSVL motifs.
Significance in milk role in bovine milk fat synthesis during the lactation cycle
PTMs Phosphorylation at Ser/Tyr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KHW5|ACBG1_BOVIN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Bos taurus OX=9913 GN=ACSBG1 PE=2 SV=1 MPDSRAAPQESLLDASLGTTQENVGTSSLTDGQTLS*36KEPLSHALKLSTPEKVKDAQLNPP EEALWTTRADGRVRLRIDPICSQTPRTVHQMFSTTLDKYGDLSAMGFKRQGTWEHISYTQ YYLLARKAAKGFLKLGLERAHSVAILAFNSPEWFFSAVGAVFGGGIITGIYTTSSPEACQ YIAYDCRANIIVVDTQKQLEKILKIWKHLPHLKAVVIYREAPPMRMPSVYTMEELMELGN EVPEEALDVIINAQKPNQCCALVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIQPAEI QQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFAEPDALKGSLVNTLREVEPTSHMGVPR VWEKIMEQIQEVAAQSGFIWRKMLLWAMSVTLEQNLTCPSSDLKPFTTRLADYLVLAKVR QALGFAKCQKNFYGAAPMTAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSG KVVPGCQVKLVNEDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDAEGWLHTGDTGRLDAD GFLYITGRLKELIITAGGENVPPVPIEEAVKTELPIIRNAMLIGDQRKFLSMLLTLKCTL DPDTFEPTDNLTEQAVEFCQRVGSKATTVSEVVGKKDEAVY*641QAIEEGIQRVNMNAAARPY HIQKWAILEKDFSISGGELGPTMKLKRLAVLEKYKDVIDSFYQEQKSKQGSSLPGFSLRW QTGASS
Predicted Disorder Regions (1-62), (709-726)
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments The BGM enzyme shares several features with other ACSs: (i) it is able to activate LCFA and VLCFA; and (ii) shows a distinct tissue distribution
Bibliography 1.Fraisl P, Tanaka H, Forss-Petter S, Lassmann H, Nishimune Y, Berger J. A novel mammalian bubblegum-related acyl-CoA synthetase restricted to testes and possibly involved in spermatogenesis. Arch Biochem Biophys. 2006 Jul 1;451(1):23-33. doi: 10.1016/j.abb.2006.04.013. Epub 2006 May 8. PMID: 16762313. 2. P.A. Watkins, Prog. Lipid Res. 36 (1997) 55–83. 3. S.J. Steinberg, J. Morgenthaler, A.K. Heinzer, K.D. Smith, P.A. Watkins, J. Biol. Chem. 275 (2000) 35162–35169.