Search by BoMiProt ID - Bomi6834


Primary Information

BoMiProt ID Bomi6834
Protein Name Little elongation complex subunit 2/Interactor of little elongator complex ELL subunit 2/NMDA receptor-regulated protein 2
Organism Bos taurus
Uniprot IdQ0VCQ7
Milk FractionWhey
Ref Sequence Id NP_001069733.1
Aminoacid Length 981
Molecular Weight 109914
Fasta Sequence https://www.uniprot.org/uniprot/Q0VCQ7.fasta
Gene Name ICE2/NARG2
Gene Id 541255
Protein Existence Status reviewed

Secondary Information

Protein Function little elongation complex (LEC)-which contains the transcription elongation factor ELL/EAF-was found to be required for the transcription of Pol II-dependent small nuclear RNA (snRNA) genes.
PTMs Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VCQ7|ICE2_BOVIN Little elongation complex subunit 2 OS=Bos taurus OX=9913 GN=ICE2 PE=2 SV=1 MTSMMAMGEPRLNWDVS*17PKNGLKTFFSRENYKDQSMAPSLKELCILSSRRIGENLNASAG SVENEPTVNSAAQAKEKVKTTVGMVLLPKPRVPYPRFSRFSQREQRNYVDLLVKYAKVPP NSKTVGINKNDYLQYLEMKKHVNEEVTEFLKFLQNSAKKCAQDYNMLSDDACLVTEQILK ACIEQVKKYPEFYTLHEVTSLMGFFPFRIEMGFKLEKTLLALGSVKYVKTVFPSMPAKLQ LSKDTIPAIETPEQIAAAMHYDISEDPNAEKLVARYHPQIALTSQSLFTLLNNHGPSYKE QWEIPVCIQVIPVAGSKPIKVIYINS*326PLPQKKMTMRERNQIFHEVPLKFMMSKNTSVPVS AVFMDKPEEYISEMDISYEVNECRKIETLENLDLEFDDDVTELETFGATTTKPSKSPSPA STSTVAPMTDTLTAPSIADTSEAPTSPDISAHSRSLSQILMEQLQKEKQLVTGMIDSGPE ESKNKDDQRFIPCGEKVSNSDKPLVQDSDLKTSDPLQLESSMEIETSSKNDMATEMESVD ERVNVLENTDTNSKEKTVTSEAANTEDVVLDSS*573DT*575DEDCLIIDMECQSNSHGKTAEVGSN LSSKPASLNSSSGQTSTGNQTNSTCPEESCVLKKPIKRVYKKFDPVGEILKMQDELLKPI SRKIPELPLMNSENSKQPPISEQPSAPSDACSWPKSIWPSAFQKPKGRLPYELQDYVEDT SEYVAPQEGNFVYKLFSLQDLLLLVRCSVQRIETRPRSKKRKKIRRQFPVYVLPKVEYQA CYGVEALTESELCRLWTESLLHSNSSFYVGHIDAFTSKLFLLEEITSEELKEKLSALKIS SLFNILQHILRKLSSLQEGSYLLSHAAEDSSLLIYKTSDGKVTRTAYNLHKTHCGLPGVP SSLSVPWVPLDPSLLLPNHIHHGRIPCTFPPKSLGPTAQQKIGGTRMPTRSHRNSVSVET KSLPAQQVENEGVASSKRKIT
Predicted Disorder Regions 59-73, 409-456, 491-622, 680-689, 757-760, 975-981
DisProt Annotation
TM Helix Prediction no TM helices
Bibliography 1.Takahashi H, Takigawa I, Watanabe M, Anwar D, Shibata M, Tomomori-Sato C, Sato S, Ranjan A, Seidel CW, Tsukiyama T, Mizushima W, Hayashi M, Ohkawa Y, Conaway JW, Conaway RC, Hatakeyama S. MED26 regulates the transcription of snRNA genes through the recruitment of little elongation complex. Nat Commun. 2015 Jan 9;6:5941. doi: 10.1038/ncomms6941. PMID: 25575120; PMCID: PMC4646223.