Search by BoMiProt ID - Bomi6820


Primary Information

BoMiProt ID Bomi6820
Protein Name Limbin
Organism Bos taurus
Uniprot IdQ8MI28
Milk FractionWhey
Ref Sequence Id NP_776352.1
Aminoacid Length 1209
Molecular Weight 137812
Fasta Sequence https://www.uniprot.org/uniprot/Q8MI28.fasta
Gene Name EVC2
Gene Id 280834
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells found in bone tissues
Protein Function Component of the EvC complex that positively regulates ciliary Hedgehog (Hh) signaling. Plays a critical role in bone formation and skeletal development. May be involved in early embryonic morphogenesis.
Significance in milk skeletal development and bone formation
PTMs Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q8MI28|LBN_BOVIN Limbin OS=Bos taurus OX=9913 GN=EVC2 PE=2 SV=1 MKFSKEIEVFNPPLASSASSGPWVHSVFAFTHSWPRKTLFKRDSAVTHRLYGDISRDFQG TSENGVIFQKCAVVSVQSEWPSAHVRLFVNNTRTPTAANLSDLFLLDNITGLTIRESAGN*120 QTSRGFQAFRKKFLQVGDSFSVSYTASLEARDVGSGDILLLPAQLSFQSSSPNRTQLKAP FTITAEEKITVLPNHGLHAAGFCVAFILSLVLTWAVLFFMVRYQCVKGSSLTRHQVQHHE NKLEHSQFTSADGVNEDLALNDQMIDILSSEDPGSMLQALEELEIATLNRADSDLEACRT QISKDIIALLLKNLTSSGQLSPQVERRMGAVFKKQFLLLEKEIQEEYDRKMVALTAECDL ETRKKTESQYQREMAAMEEAEEVLKRVSERSAVECSSLLRTLHGLEQEHLRRSLALQQEE DLAKAHRQLAIFQRNELHNIFFTQIKSAIFKGELKPEAAKMLLQDYSKIQESVEELMDFF QASKRYHLSKRFGHREYLVQNIQSSETRMQGLLSTASAQLTLLIQKHERAGYLDEDQMQV LLERAQTEVFSIKQKLDNDLKQEKKKLHQKLIIKRRREMLQKHKEQRREQLSIAEASGAA EDAGQYLGQWRGLMAEHSAALEELQERLDQAALDELRALTLSLSEKATEELRRLQNSGMT QELLKRGVPWLFLQQILEEHSRDLAARAERLEGEERDRGQEGVQSVRQRLKDDALEASTE EQAELRHWEHLIFTKLCSSAFSLSEEELLGMRQEVHGCFAQMDRSLALPKIRARVLLQRF QTAWREAEFLKLDQAMTAPELQPQSKARKPRSKSRSKIDLLKKCTEDKIQLFKEQAPEDL VEKVRGELLRERVQQLEAQEGLFAESLVSLQFQKAARMARTLWAYTALLSIQDLLLEELN SSETLTKSACMQILESHSPELQELERKLEDQLAHQEAAQLQRALDSWQQWAGEGPALLQE PEETDSERHVSAVLQRALSKGQKLLEYHQQSLREEQEDSVVLEDLLENMETDTFVTLYGQ ELRLASYLSKLTMLPGGTLRRLLTVALPAASQAELLAVLDSVGQKHQDHSVENDGSRVQA DLGRRGKHQGWWQALESKLRGELINRGLEKMLWAQKRKESILKKTCPPLRERVIFSGKRS WPHLSLESTDELTPVPIVGAEAVDLLNTGEKLFIFRNPKEPEISLHVPPRKKKKNFLNAK KAAWALGLN
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 1TMH; (196-218)