Search by BoMiProt ID - Bomi6814


Primary Information

BoMiProt ID Bomi6814
Protein Name LIM domain-containing protein ajuba
Organism Bos taurus
Uniprot IdE1BKA3
Milk FractionWhey
Ref Sequence Id NP_001179446.1
Aminoacid Length 548
Molecular Weight 57765
Fasta Sequence https://www.uniprot.org/uniprot/E1BKA3.fasta
Gene Name AJUBA
Gene Id 519937
Protein Existence Status reviewed

Secondary Information

Protein Function nucleocytoplasmic Shuttling.Ajuba is a new cytosolic component of the IL-1 signaling pathway modulating IL-1-induced NF-kappaB activation.Acts as a transcriptional corepressor for SNAI1 and SNAI2/SLUG-dependent repression of E-cadherin transcription.
Biochemical Properties three tandemly arranged LIM domains in the C-terminal region.The LIM domain defines a unique double zinc finger structure found in a class of proteins involved in cell identity, differentiation, and growth control . The LIM motif, CX2CX16–23HX2CX2CX2C-X16–21CX2C(D,H).Amino-terminal pre-LIM domain is abundant in glycine and proline residues.There are two potential SH3 recognition motifs within the pre-LIM domain.pre-LIM domain of Ajuba interacts with the SH3 domains of Grb2.
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|E1BKA3|AJUBA_BOVIN LIM domain-containing protein ajuba OS=Bos taurus OX=9913 GN=AJUBA PE=3 SV=1 MERLGEKASRLLEKLRLSDSGSAKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPR GAAGGPGDEPLEPAREQGPLDAERNPRGS*89FEVPRYEGSFPGGPPPSRALPLPQSLPPDFR LETTAPALS*129PRSSFASSSASDAS*143KPSSPRGSLLLDGAGAGGAGGSRPCSNRTSGISMGYD QRHGS*185PLPAGPCLFGPPLAGVPAGYSSGGVPSAYPELHAALDRLCAHRPAGFGCQESRHS YPPALGSPGALAGAGVGATGPLERRGAQPGRHS*273VTGYGDCAAGARYQDELTALLRLTVGT GGREAGVRGESAGIEASGLEEPPGAFVPEAARARIREPESREDYFGTCIKCNKGIYGQSN ACQALDSLYHTQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLI LEKILQAMGKSYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKSYAPKCAACGQPI LPSEGCEDIVRVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLSA RQPPANYI
Predicted Disorder Regions 15-118, 128-163, 183-211, 224-277
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Goyal RK, Lin P, Kanungo J, Payne AS, Muslin AJ, Longmore GD. Ajuba, a novel LIM protein, interacts with Grb2, augments mitogen-activated protein kinase activity in fibroblasts, and promotes meiotic maturation of Xenopus oocytes in a Grb2- and Ras-dependent manner. Mol Cell Biol. 1999 Jun;19(6):4379-89. doi: 10.1128/MCB.19.6.4379. PMID: 10330178; PMCID: PMC104397.