Search by BoMiProt ID - Bomi6813


Primary Information

BoMiProt ID Bomi6813
Protein Name LIM domain-containing protein 1
Organism Bos taurus
Uniprot IdG5E5X0
Milk FractionWhey
Ref Sequence Id NP_001180092.1
Aminoacid Length 674
Molecular Weight 71885
Fasta Sequence https://www.uniprot.org/uniprot/G5E5X0.fasta
Gene Name LIMD1
Gene Id 617525
Protein Existence Status reviewed

Secondary Information

Protein Function Positively regulates microRNA (miRNA)-mediated gene silencing and is essential for P-body formation and integrity.Mitotic phosphorylation of LIMD1 is required for its inhibitory activity in cell proliferation and anchorage-independent growth
PTMs Phosphorylated
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|G5E5X0|LIMD1_BOVIN LIM domain-containing protein 1 OS=Bos taurus OX=9913 GN=LIMD1 PE=3 SV=1 MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQ QQQQLLQEETLPRASRGPINGGARLGPPAHREAGGGSKLAADGAAKPPLAASTVAPGTTI TVAPGQPSYPPQEQRAKLYVRGSRQGS*147QDCGSKESMVNSEMSAFHRPGPCEDPSCLTHGD YYDNLSLAGPKWADDPGVSPGIRLGVGSGWSGTPGSDPLLSKPSRDPHLYHQQLS*235AGSGR S*241LQSGQDGGPGGGNSEKPAGVWTTASSQRVS*271PGLPS*276AGPENGALPRSAQPRTPSFSAPLA LNRPSQGSLPRTNS*314GVGSEVSGTMPKPTVDPQPWFQDGPKSYLSSSAPSSSPASMDHMQA GALPGLGPKPGSTDPGIGPKLSPNSLVHPVMSTLPELSCKEGASSWASDGSLGPVLPETP SS*422PRVRLPCQTLIPGPELGPTAAELKLEALTQRLEREMDAHPKADYFGACVKCSKGVFGA GQACQAMGNLYHDACFTCAACSRKLRGKAFYFVNGKVFCEEDFLYSGFQQSADRCFLCGH LIMDMILQALGKSYHPGCFRCVICNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGL PILPPEGSDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVKRL EKGPSPAALRQHHF
Predicted Disorder Regions 5 disordered segments; (71-75), (101-195), (211-314), (330-352), (367-393)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs S272, S277, S421, and S424 are the main phosphorylation sites in LIMD1.phosphorylation of LIMD1 is required for proper mitotic progression.
Bibliography Zhou J, Zhang L, Zhou W, Chen Y, Cheng Y, Dong J. LIMD1 phosphorylation in mitosis is required for mitotic progression and its tumor-suppressing activity. FEBS J. 2019 Mar;286(5):963-974. doi: 10.1111/febs.14743. Epub 2019 Jan 16. PMID: 30600590.