Search by BoMiProt ID - Bomi6799


Primary Information

BoMiProt ID Bomi6799
Protein Name LIM and cysteine-rich domains protein 1
Organism Bos taurus
Uniprot IdQ17QE2
Milk FractionWhey
Ref Sequence Id NP_001069690.1
Aminoacid Length 363
Molecular Weight 40723
Fasta Sequence https://www.uniprot.org/uniprot/Q17QE2.fasta
Gene Name LMCD1
Gene Id 540474
Protein Existence Status reviewed

Secondary Information

Protein Function required for thrombin-induced smooth muscle cell proliferation and promotes atherogenesis
Biochemical Properties LMCD1 acts as a co-activator for E2F1 in the modulation of thrombin-induced CDC6 expression in promoting HASMC replication.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q17QE2|LMCD1_BOVIN LIM and cysteine-rich domains protein 1 OS=Bos taurus OX=9913 GN=LMCD1 PE=2 SV=1 MAKVAKDLNPRVQKMS*16LGQQQSARGVPCLRCKGTCSGFEPHSWRKICKSCKCSQEDHCLS SDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEW APPGVTQKLGLQYMELIPKEKQPVTGTEGALYRRRQLMHQLPIYDQDPSRCRGLLENELK VMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETAPPTTNGSIGDPSKEYV CELCKGVAPADSPVVYSDRAGYSKQWHPACFVCAKCSEPLVDLIYFWKDGAPWCGRHYCE SLRPRCSGCDEIIFSEDYQRVEDLAWHRKHFVCEGCEQQLGGRAYIVTMGQLLCPTCSKS KRS
Predicted Disorder Regions 1-27, 52-57, 201-236
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments LMCD1 (LIM and cysteine-rich domains 1) as a gene highly responsive to thrombin in human aortic smooth muscle cells
Bibliography 1.Janjanam J, Zhang B, Mani AM, Singh NK, Traylor JG Jr, Orr AW, Rao GN. LIM and cysteine-rich domains 1 is required for thrombin-induced smooth muscle cell proliferation and promotes atherogenesis. J Biol Chem. 2018 Mar 2;293(9):3088-3103. doi: 10.1074/jbc.RA117.000866. Epub 2018 Jan 11. PMID: 29326163; PMCID: PMC5836108. 2.