Search by BoMiProt ID - Bomi6783


Primary Information

BoMiProt ID Bomi6783
Protein Name Leukocyte surface antigen CD53/Cell surface glycoprotein CD53
Organism Bos taurus
Uniprot IdQ58DM3
Milk FractionExosomes
Ref Sequence Id NP_001029404.1
Aminoacid Length 219
Molecular Weight 24103
Fasta Sequence https://www.uniprot.org/uniprot/Q58DM3.fasta
Gene Name CD53
Gene Id 505040
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells blood
Protein Function It is required for efficient formation of myofibers in regenerating muscle at the level of cell fusion. May be involved in growth regulation in hematopoietic cells
Biochemical Properties The CD53 molecule is likely to consist of four transmembrane regions and a major extracellular hydrophilic loop containing two potential N-glycosylation sites. 
PTMs N-linked Glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q58DM3|CD53_BOVIN Leukocyte surface antigen CD53 OS=Bos taurus OX=9913 GN=CD53 PE=2 SV=1 MGMSSLKLLKFVLFFFNLIFWFCGCCILGLGIYLLIHSKFGVLFHNLPSLTLGNVLVIVG SVIMVVAFLGCMGSIKENKCLLMSFFVLLLIILLAEVTLAILLFVYEQKLKEYVAEGLTE SIQRYNSDN*129STKAAWDSIQSFLQCCGVN*148GTSDWTSGPPASCPKGSAVKGCYIQAKQWFHS NFLYIGITTICVCVIQVLGMSFALTLNCQIDKTSQVLGL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 4TMHs; (13-35),(47-69),(82-104),(184-206)
Additional Comments CD53 deficiency in humans has similarities to that of leukocyte adhesion deficiency patients, raising the possibility of a role for CD53 in immune cell adhesion and trafficking.
Bibliography 1.Angelisová P, Vlcek C, Stefanová I, Lipoldová M, Horejsí V. The human leucocyte surface antigen CD53 is a protein structurally similar to the CD37 and MRC OX-44 antigens. Immunogenetics. 1990;32(4):281-5. doi: 10.1007/BF00187099. PMID: 1700763. 2.Yeung L, Anderson JML, Wee JL, Demaria MC, Finsterbusch M, Liu YS, Hall P, Smith BC, Dankers W, Elgass KD, Wicks IP, Kwok HF, Wright MD, Hickey MJ. Leukocyte Tetraspanin CD53 Restrains α3 Integrin Mobilization and Facilitates Cytoskeletal Remodeling and Transmigration in Mice. J Immunol. 2020 Jul 15;205(2):521-532. doi: 10.4049/jimmunol.1901054. Epub 2020 Jun 12. PMID: 32532837.