Search by BoMiProt ID - Bomi6770


Primary Information

BoMiProt ID Bomi6770
Protein Name Leucine-rich repeat-containing protein 41
Organism Bos taurus
Uniprot IdQ29RR1
Milk FractionWhey
Ref Sequence Id NP_001039338.1
Aminoacid Length 814
Molecular Weight 88677
Fasta Sequence https://www.uniprot.org/uniprot/Q29RR1.fasta
Gene Name LRRC41
Gene Id 337889
Protein Existence Status reviewed

Secondary Information

Protein Function MUF1 (LRRC41, leucine-rich repeat containing 41) as a potential interaction partner of RhoBTB3
Biochemical Properties MUF1 is a largely uncharacterized protein containing a leucine-rich repeat and, interestingly, a BC-box that serves as a linker in multicomponent, cullin 5 (Cul5)-based ubiquitin ligases
PTMs Phosphorylation at Ser/thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29RR1|LRC41_BOVIN Leucine-rich repeat-containing protein 41 OS=Bos taurus OX=9913 GN=LRRC41 PE=2 SV=1 MAAPEAWRARSCWFCEVAAATTMEATSREAAPAKSSASGPSAPPALFELCGRAVSAHMGV LESGVWALPGPILQSILPLLNIYYLERIEETALKKGLSTQAIWRRLWDELMKTRPSSLES VTCWRAKFMEAFFSHVLRGTIDVSSDRRLCDQRFS*155PLLHSSRHVRQLTICNMLQGATELV AEPNRRVLETLASSLHTLKFRHLLFSDVAAQQSLRQLLHQLIHHGAVSQVSLYSWPVPES ALFILILTMSAGFWQPGPGGPPCRLCGEASRGRAPS*276RDEGSLLLGSRRPRRDAAERCAAA LMASRRKSEAKQTARAAPATRVTRRS*326T*327QESLTAGGTDSKREPLPPATSHEAPGTKRPPSA PATTSSASASSSTSS*375SKRAPASSAPQPKPLKRFKRAAGKKGARTRQGCGAESEDLYDFVF IVAGEKEDGEEMEIGEVACGALDGSDPSCLGLPALEASQRFRSISTLELFTVPLSTEAAL TLCHLLSSWVSLESLTLSYNGLGSNIFRLLDSLRALSVQAGCRLRALHLSDLFSPLPILE LTRAIVRALPLLRVLSIRVDHPSQRDNPAVPGNAGPPSNVIGDEEIPENCLEQLEMGFPR GAQPAPLLCSVLKASGSLQQLSLDSATFASPQDFGLVLQTLKEYNLTLKRLSFHDMNLAD CQSEVLFLLQNLTLQEITFSFCRLFEKRPAQFLPEMVAAMKGNSTLKGLRLPGNRLGNAG LLALADVFSEDSSSSLCQLDISSNCIKPDGLLEFAKRLERWGRGAFGHLRLFQNWLDQDA VTAREAIRRLRATCHVVSDSWDSSQAFADYVSTM
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs LRRK2 is highly phosphorylated with two notable classes of phosphorylation sites, one of autophosphorylation sites clustering in or near LRRK2’s Ras-GTPase-like domain (termed ROC) and another of heterologous phosphorylation sites in the N-terminal ANK-LRR interdomain region.Phosphorylation gives the evidence of a physiological role for an organism. LRRK2 phosphorylation
Additional Comments MUF1 is degraded in the proteasome in a Cul5-independent manner by RhoBTB3-Cul3 ubiquitin ligase complex.
Bibliography 1.Schenková K, Lutz J, Kopp M, Ramos S, Rivero F. MUF1/leucine-rich repeat containing 41 (LRRC41), a substrate of RhoBTB-dependent cullin 3 ubiquitin ligase complexes, is a predominantly nuclear dimeric protein. J Mol Biol. 2012 Oct 5;422(5):659-673. doi: 10.1016/j.jmb.2012.06.016. Epub 2012 Jun 15. PMID: 22709582. 2.Gloeckner, Christian Johannes; Boldt, Karsten; von Zweydorf, Felix; Helm, Sandra; Wiesent, Ludwig; Sarioglu, Hakan; Ueffing, Marius (2010). Phosphopeptide Analysis Reveals Two Discrete Clusters of Phosphorylation in the N-Terminus and the Roc Domain of the Parkinson-Disease Associated Protein Kinase LRRK2. Journal of Proteome Research, 9(4), 1738–1745. doi:10.1021/pr9008578.