Search by BoMiProt ID - Bomi6768


Primary Information

BoMiProt ID Bomi6768
Protein Name Leucine-rich repeat-containing G-protein coupled receptor 5
Organism Bos taurus
Uniprot IdF1MT22
Milk FractionWhey
Aminoacid Length 907
Molecular Weight 99415
Fasta Sequence https://www.uniprot.org/uniprot/F1MT22.fasta
Gene Name LGR5
Protein Existence Status reviewed

Secondary Information

Protein Function member of the G protein-coupled receptors.The ligand for LGR5 is R-spondin, and following ligand-receptor binding, it forms a protein complex with frizzled lipoprotein receptor-related proteins 5 and 6. Subsequently, this complex positively regulates the Wnt signaling pathway .
Biochemical Properties  seven transmembrane domains,contains <18 leucine-rich repeats, each composed of 24 amino acids.The ligand for LGR5 is R-spondin.
PTMs disulfide bond formation,glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|F1MT22|LGR5_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Bos taurus OX=9913 GN=LGR5 PE=3 SV=2 MDTSSVGVLLSLPVLLQLAAGGGSPRPGTLLRGCPAHCQCEPDGRMLLRVDCSDLGLSEL PSN*63LSVFTSYLDLSMNN*77ISQLPPSPLHSLRFLEELRLAGNALTYIPKGAFAGLYSLKVLM LQNNHLRQVPTEALQNLRSLQSLRLDANRISSVPPSCFSGLHSLRHLWLDDNALTEIPVQ AFRSLSALQAMTLALNKIHHIPDYAFGN*208LSSLVVLHLHNNRIHSLGKKCFDGLHSLETLD LNYNNLDEFPTAVRTLSNLKELGFHSNNIKSIPEKAFVGNPSLITIHFYDNPIQLVGRSA FQHLPELRTLTLNGASQITEFPDLTGTASLESLTLTGAQISSLPQTVCDQLPNLQVLDLS YNLLEDLPSFSVCQKLQKIDLRHNEIYEIQADTFQQLFSLRSLNLAWNKIAIIDPNAFST LPSLRKLDLSSNRLSSIPVTGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCC AFGVCENVYKISNPWSKGDN*500STAEDLHKKDAGVFQVQDERDLEDFLLDFEEDLRALHPVR CSPSPGPFKLCEYLFGSWLIRIGVWTIAVLALTCNALVTSTVFRAAVYISSIKLLIGLIA AVNMLMGVSSAVLAGVDAFTFGSFAQHGAWWEQAVGCQVVGFLSIFASESSVFLLTLAAL ERGWSVKCSAKFETQTPFPSLRATLALCALLAGTVAAVPLLGGSEYSASPLCLPLPFGEP RATGYMVALVLLNSLCFLVMTVAYTRLYCHLEKGDLESMWDCSMVKHVALLLFTNCILHC PVAFLSFSSLLN*792LTFISPEVIKFILLVIVPLPACLNPLLYILFNPHFKEDLGSLGKQTHF WTRSKHTSLMSINSDDVEKQSCDSTQALVTFTSASIAYDLPSSSGSPPAYPMTESCHLSS VAFVPCL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 7TMHs; (565-587), (594-616), (638-660), (681-703), (722-744),(769-791), (800-822)
Significance of PTMs Under normal conditions, LGR5 is glycosylated and folded in the ER after translation and is trafficked to the plasma membrane.
Additional Comments Lgr5 expression was predominantly restricted to the pyloric glands contributing to epithelial self-renewal, and could serve as a unique marker of stem cells in the stomach.
Bibliography 1.Xi HQ, Cai AZ, Wu XS, Cui JX, Shen WS, Bian SB, Wang N, Li JY, Lu CR, Song Z, Wei B, Chen L. Leucine-rich repeat-containing G-protein-coupled receptor 5 is associated with invasion, metastasis, and could be a potential therapeutic target in human gastric cancer. Br J Cancer. 2014 Apr 15;110(8):2011-20. doi: 10.1038/bjc.2014.112. Epub 2014 Mar 4. PMID: 24594994; PMCID: PMC3992491. 2.Huang T, Qiu X, Xiao J, Wang Q, Wang Y, Zhang Y, Bai D. The prognostic role of Leucine-rich repeat-containing G-protein-coupled receptor 5 in gastric cancer: A systematic review with meta-analysis. Clin Res Hepatol Gastroenterol. 2016 Apr;40(2):246-53. doi: 10.1016/j.clinre.2015.07.009. Epub 2015 Sep 19. PMID: 26387842.