Search by BoMiProt ID - Bomi6767


Primary Information

BoMiProt ID Bomi6767
Protein Name Leucine-rich repeat and fibronectin type-III domain-containing protein 3/Synaptic adhesion-like molecule 4
Organism Bos taurus
Uniprot IdQ1RMS4
Milk FractionWhey
Ref Sequence Id NP_001070427.1
Aminoacid Length 628
Molecular Weight 66260
Fasta Sequence https://www.uniprot.org/uniprot/Q1RMS4.fasta
Gene Name LRFN3/SALM4
Gene Id 767839
Protein Existence Status reviewed

Secondary Information

Protein Function Cell adhesion molecule mediating cell-cell adhesion in a Ca2+-independent manner. Promotes neurite outgrowth in hippocampal neurons.
PTMs Disulphide bond, Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1RMS4|LRFN3_BOVIN Leucine-rich repeat and fibronectin type-III domain-containing protein 3 OS=Bos taurus OX=9913 GN=LRFN3 PE=2 SV=1 MAVLPLLLCLLPLAPASSPPQPASPSPCPRRCRCQTQSLPLSVLCPGAGLLFVPPSLDRR AAELRLADNFIATVRRRDLANMTGLLHLSLSRNTIRHVAAGAFSDLRALRALHLDGNRLT SLGEGQLRGLVNLRHLILSNNQLAALAAGALDDCAETLEDLDLSYNNLEQLPWEALGRLG NVNTLGLDHNLLASVPAGAFSRLHKLARLDMTSNRLTTIPPDPLFSRLPLLARPRGSPAS ALVLAFGGNPLHCNCELVWLRRLAREDDLEACASPPALGGRYFWAVGEEEFVCEPPVVTH RSPPLAVPAGRPAALRCRAVGDPEPRVRWVSPQGRLLGNSSRARAFPN*348GTLELLVTEPGD GGIFTCIAANAAGEATAAVELTVGPPPPPQLAN*393STSCDPPRDGEPDALTPPSAASASASA KAAEAGPPTDRGVQVTEHGATAALIQWPDQRPIPGIRMYQIQYNSSADDILVYRMIPAES SSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCNRFSTEPALRPCGAPHAPFLGGT MIIALGGVIVASVLVFIFVLLMRYKVHGGQPPGKTKASAPVSSVCSQTNGALGPMPAPPA PEPSAPRAHTVVQLDCEPWGPSHEPMGP
Predicted Disorder Regions (20-26), (384-428), (522-526), (569-628)
DisProt Annotation
TM Helix Prediction 1TMH; (539-561)
Significance of PTMs N-glycosylated.
Bibliography Bovine Genome Sequencing and Analysis Consortium, Elsik, C. G., Tellam, R. L., Worley, K. C., Gibbs, R. A., Muzny, D. M., Weinstock, G. M., Adelson, D. L., Eichler, E. E., Elnitski, L., Guigó, R., Hamernik, D. L., Kappes, S. M., Lewin, H. A., Lynn, D. J., Nicholas, F. W., Reymond, A., Rijnkels, M., Skow, L. C., Zdobnov, E. M., … Zhao, F. Q. (2009). The genome sequence of taurine cattle: a window to ruminant biology and evolution. Science (New York, N.Y.), 324(5926), 522–528. https://doi.org/10.1126/science.1169588