Search by BoMiProt ID - Bomi6722


Primary Information

BoMiProt ID Bomi6722
Protein Name Latent-transforming growth factor beta-binding protein 2
Organism Bos taurus
Uniprot IdQ28019
Milk FractionWhey
Ref Sequence Id NP_776810.1
Aminoacid Length 1842
Molecular Weight 198410
Fasta Sequence https://www.uniprot.org/uniprot/Q28019.fasta
Gene Name LTBP2
Gene Id 281905
Protein Existence Status reviewed

Secondary Information

PTMs Disulfide bond, Glycosylation, Hydroxylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q28019|LTBP2_BOVIN Latent-transforming growth factor beta-binding protein 2 OS=Bos taurus OX=9913 GN=LTBP2 PE=1 SV=2 MRPPTTARCPGRVLQNPWRSFWPLTLALFVGMGQAQRDPVGRYEPAGRDASRLRRPGGSP VVATAKVYSLFREQDAPVRGSPPAELVQPSWGSPRRSTEAEARRPPRAQQPRRVQPPAQT WRSRPSGQQQSAPRARAAPALPRLETVQRPRAARGRLTGRNVCGGQCCPGWTTAN*175STNHC IKPVCQPPCQNRGSCSRPQLCVCRSGFRGARCEEVIPEEEFDPQNSRPAPRRSAEGPPSL RRSSVARESTTARVRPPAPQLQRARTLSGLSQTRSSQQHVGLSQTTRLYPAPAASGQLTS NALPMGPGPERRDGAPQAAYLDRPSSSWGLN*331LTEKIKKIKIVFTPTICKQTCARGRCANS CERGDTTTLYSQSGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPAN*409STGKFCHLPAP RLDQEPPERGPRHRAPLEGPLKQSTFTLPLSNQLASVNPSLVNVHIRHPPEASVQIHQVA RVRGEAEEAPEENS*494VETRPSPRLPAGPGPGRWDSNRIPARSGEAPRLPPPVVPRTPALLG RCYLSTLNGQCANPLPELTAHEDCCGSVGAFWGVTSCAPCPPRPASPVIENGQLECPQGY KRLN*604LTHCEDVNECLTLGLCEDSECVNTRGSYLCTCRPGLLLDPSRSRCVSDKAVSMQQG LCYRLLGPGTCALPLAQRITKQICCCSRVGKAWGSLCEKCPLPGTEAFREICPAGHGYTY SSSDIRLSMRKAEEEELARPSRDRGPKRN*749GTLPRPAERQPLRAATGTWVEAETIPDKGDS QASQVTTSVTQLSTWVPGGALGTPTPSVPEQGIPEAREEAQVTAPTNVLVTPAPSGIDRC AAGATNICGPGTCVNLPDGYRCICSPGYRLHPSQAYCTDDNECLRDPCKGRGRCVNRVGS YSCFCYPGYKLATSGATQECQDIDECEQPGVCSRGRCTNTEGSYHCECDQGYIMVRKGHC QDINECRHPGTCPDGKCVNSPGSYTCLPCEEGYRGQGGSCVDVNECLTPGVCTHGTCINL EGSFRCSCEQGYEVTPDEKGCKDVDECAIRASCPTGLCLNTEGSFTCSACESGYWVNEDG TACEDLDECAFPGVCPSGVCTNTAGSFSCRDCEAGYQPSALGHTCEDVDECEDPQSSCLG GECKNTAGSYQCLCPPGFQLAN*1162GTVCEDVDECVGEEYCAPRGECLNSHGSFFCLCADGFV SADGGTSCQDVDECAVTDRCVGGQCVNTDGSFNCVCETGFQPSPESGECVDIDECEDLGE PICGAWRCENSPGSYRCVLGCQPGFHMAPTGDCIDIDECAN*1301DTVCGSHGFCDNTDGAFRC LCDQGFETSPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYDAQEGRCRP RGAGGPSVPEARPGAHPPGPVRMECYSGQKDQTPCSSLLGRN*1422TTQAECCCTQGTGWGDAC DLCPDEDSVEFSEICPSGKGYIPVEGAWMFGQTTYTDADECVMFGPGLCRNGRCLNTVPG YICLCNPGYHYNAASRKCEDHDECQDMACENGECVNTEGSFHCFCSPPLTLDLSQQRCVN*1560 STSGVEDLPDHDIHMDICWKRVTNYVCSHPLHGRRTTYTECCCQDGEAWSQQCALCPPRS SEVYAQLCNVARIEAEREAGIHFRPGYEYSPGPDDLHYSLYGPDGVPFYNYLGPEDAIPE PLFPSTAGRPGDRIPLPEPPLQPSELQPHYVASHPGLCCCKNGEEVGSEAVSLPSSPSAH HCQQEHQAGFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDTAHMACVDVNECD DLNGPAALCVHGHCDNTEGSYRCHCLPGYVAEAGPPHCTAKE
Predicted Disorder Regions 3 predicted disordered segments;(96-137), (221-232), (480-483)
DisProt Annotation
TM Helix Prediction No TM helices