Search by BoMiProt ID - Bomi6708


Primary Information

BoMiProt ID Bomi6708
Protein Name Large subunit GTPase 1 homolog
Organism Bos taurus
Uniprot IdQ2YDM7
Milk FractionWhey
Ref Sequence Id NP_001039375.1
Aminoacid Length 652
Molecular Weight 74249
Fasta Sequence https://www.uniprot.org/uniprot/Q2YDM7.fasta
Gene Name LSG1
Gene Id 505082
Protein Existence Status reviewed

Secondary Information

Protein Function Role in ribosome biogenesis.required for the XPO1/CRM1-mediated nuclear export of the 60S ribosomal subunit.
Biochemical Properties Nmd3 is a structural mimic of eIF5A, and activates the cpGTPase Lsg1 during 60S ribosome biogenesis.Activation of Lsg1 GTPase requires both Nmd3 and 60S subunits.
PTMs phosphorylation on See
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2YDM7|LSG1_BOVIN Large subunit GTPase 1 homolog OS=Bos taurus OX=9913 GN=LSG1 PE=2 SV=1 MGRRRAPEGGTLGRALIRQQVQRSRSHRHTDSWLHTSELNDGYDWGRLNLQSVTEQSSLD DFLATAELAGTEFVAEKLNIKFVPPEARTGLLS*93FEENQRIKKLHEENKQFLCIPRRPKWD QKTSPEELKQAEKDNFLEWRRQLVWLEEEQNLILTPFERNLDFWRQLWRVIERSDIVVQI VDARNPLLFRCEDLECYVKTIDDNKENVILINKADLLTAEQRSAWAEFFKKENVKVIFWS ALAEAIKLMGNS*252KGDVNGDTGEAITAEFENSSCDEAEILHKETEHLSLGEAASSEEDESE YEDCQEEEEDWQTCLEDSSSSDEEACGQDCKEGHTVDSEAQGRNTPQKRQIHNFSHLVSK QELLEVFKQLHSGKKVKDGQLTVGLVGYPNVGKSSTINTILGNKKVSVSATPGHTKHFQT LYVEPGLCLCDCPGLVMPSFVSTKAEMICSGILPIDQMRDHVPPVSLVCQNIPRHVLEAT YGIDIIKPREDEDPRRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARYILKDYVNGKLLY CHPPPGRDPVTFQYQHQRLLEKKVNGGEIKLQVVRNKKVYQIENVVDKAFFHQENVRALT KGVQAVMGYKPGSGLVTAAAVSSERGAGKPWKKHGNRNKKEKSRRLYKHLDM
Predicted Disorder Regions 270-346, 492-499, 623-652
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Malyutin AG, Musalgaonkar S, Patchett S, Frank J, Johnson AW. Nmd3 is a structural mimic of eIF5A, and activates the cpGTPase Lsg1 during 60S ribosome biogenesis. EMBO J. 2017 Apr 3;36(7):854-868. doi: 10.15252/embj.201696012. Epub 2017 Feb 8. PMID: 28179369; PMCID: PMC5376978.