Search by BoMiProt ID - Bomi6702


Primary Information

BoMiProt ID Bomi6702
Protein Name Lambda-crystallin homolog/L-gulonate 3-dehydrogenase/Gul3DH
Organism Bos taurus
Uniprot IdQ8SPX7
Milk FractionWhey
Ref Sequence Id NP_776718.1
Aminoacid Length 321
Molecular Weight 35072
Fasta Sequence https://www.uniprot.org/uniprot/Q8SPX7.fasta
Gene Name CRYL1
Gene Id 281725
Protein Existence Status reviewed

Secondary Information

Protein Function composition of lens
Biochemical Properties It catalyses conversion of L-gulonate to 3-dehydro-L-gulonate by utilising a NAD+ and reducing it to NADH.
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q8SPX7|CRYL1_BOVIN Lambda-crystallin homolog OS=Bos taurus OX=9913 GN=CRYL1 PE=2 SV=3 MASPGS*6SAPGGVAVVGSGLIGRSWAMLFASAGFRVKLFDIEPRQVTDALVSLRKEMKMLE LSGYLKGELGAEEQLSLISGCSDLREAVEGALHVQECVPENLELKRKLFAQLDKIADDHV ILSSSSSCLLPSKLFAGLAHVKQCLVAHPVNPPYYVPLVELVPHPETAPATVDRTYALMR RVGQSPVRLLREIDGFALNRLQYAVIAEAWRLVEEGVVSPGDLDLVMSDGLGLRYAFIGP LETMHLNAEGMLSYCDRYGEGMKRVLKTFGPVPEFSGATAEKVHQAMCVKVPDDAEHLAA RRAWRDGCLMRLAQLKHQLPQ
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Chen, J., Yu, L., Li, D., Gao, Q., Wang, J., Huang, X., Bi, G., Wu, H., & Zhao, S. (2003). Human CRYL1, a novel enzyme-crystallin overexpressed in liver and kidney and downregulated in 58% of liver cancer tissues from 60 Chinese patients, and four new homologs from other mammalians. Gene, 302(1-2), 103–113. https://doi.org/10.1016/s0378-1119(02)01095-8