Search by BoMiProt ID - Bomi6686


Primary Information

BoMiProt ID Bomi6686
Protein Name KRR1 small subunit processome component homolog/KRR-R motif-containing protein 1
Organism Bos taurus
Uniprot IdQ3B7L9
Milk FractionWhey
Ref Sequence Id NP_001032908.1
Aminoacid Length 382
Molecular Weight 43650
Fasta Sequence https://www.uniprot.org/uniprot/Q3B7L9.fasta
Gene Name KRR1
Gene Id 513714
Protein Existence Status reviewed

Secondary Information

Protein Function Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly
Biochemical Properties Component of the ribosomal small subunit (SSU) processome.
PTMs Glycyl lysine isopeptide (Lys-Gly).Phosphorylation. acetylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3B7L9|KRR1_BOVIN KRR1 small subunit processome component homolog OS=Bos taurus OX=9913 GN=KRR1 PE=2 SV=2 MAS*3SKQNGPTTASGKSELRSPKPTSENRDESELLTVPDGWKEPAFSKEDNPRGLLEESSF ATLFPKYREAYLKECWPLVQKALNEHHINATLDLIEGSMTVCTTKKTFDPYIIIRARDLI KLLARSVSFEQAIRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTN CYIMVQGNTVSAIGPFSGLKEVRKVVLDTMKNIHPIYNIKTLMIKRELAKDSELRSQSWE RFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKASQKKRQKME AIKAKQAEALSKRQEERNKAFIPPKEKPVHLKKPKEASTETKIDVAALKEKVKKAKNKKL GALTAEEVKLKMEADEKKKKKK
Predicted Disorder Regions 4 disordered segments; (1-80), (96-125), (136-175), (225-382)
DisProt Annotation
TM Helix Prediction No TM helices