Search by BoMiProt ID - Bomi6679


Primary Information

BoMiProt ID Bomi6679
Protein Name KN motif and ankyrin repeat domain-containing protein 2/Ankyrin repeat domain-containing protein 25
Organism Bos taurus
Uniprot IdQ1LZH7
Milk FractionWhey
Ref Sequence Id NP_001069999.1
Aminoacid Length 858
Molecular Weight 91957
Fasta Sequence https://www.uniprot.org/uniprot/Q1LZH7.fasta
Gene Name KANK2/ANKRD25
Gene Id 767586
Protein Existence Status reviewed

Secondary Information

Protein Function  KANK proteins are localised mainly to the plasma membrane in focal adhesions, indirectly affecting RhoA and Rac1 thus regulating actin cytoskeleton. In addition, Kank proteins are part of the cortical microtubule stabilisation complex regulating microtubules. 
Biochemical Properties  KN motif and ankyrin repeat domain-containing protein 1 (KANK1), a member of KANK family, recruits kinesin family member 21A (KIF21A) to the cell cortex to control microtubule growth via its C-terminal ankyrin domain.A stretch of ∼22 amino acids in KIF21A is sufficient for binding to KANK1 and its close homolog KANK2. Kank (Kank1)-associated members, Kank2, Kank3 and Kank4, which were found by domain and phylogenetic analyses. Besides the conserved ankyrin-repeat and coiled-coil domains, there was a conserved motif at the N-terminal (KN motif) containing potential motifs for nuclear localization and export signals.
PTMs Methy at Arg,Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1LZH7|KANK2_BOVIN KN motif and ankyrin repeat domain-containing protein 2 OS=Bos taurus OX=9913 GN=KANK2 PE=2 SV=1 MAQVLHVSAPFPGTPGPAS*19PPAFPSKEPDVPYSVETPYGYRLDLDFLKYVDDIEKGHTLR RVAVQRRPRLGSLPRGPGSWWTS*83TES*86LCS*89NAS*92GDSRHSAYSYCGRGFYPQYGALETRGGF NPRVERTLLDARRRLEDQAAAPAGLGSLTPSAAGSTSSLVGVGLPPPT*168PRGSGLSTPVPP SAGHLAHVREQMAGALRKLRQLEEQVKLIPVLQVKLSVLQEEKRQLTVQLKSQKFLGHPA GARGRGELCLDLPEAPEDPVTLETRSVGTWVRERDLGMPDGEAALAAKVAVLETQLKKAL QELQAAQARQADLPPQAWPPPDS*323PVRVDT*329VRVVQGPREVEVAASTAAGAPAQRAQS*356LEPY GAGLRALATSNGAES*375PPVFRSHEVMETVFPAPTASTSNVHQVKKISITERSCDGAAGHPQ APAESSLSPPESEGATQAQPEKNTGQVPAHDDTTIKEPIRQAACHESEFEEAGGAGGAQA GLRSIMKQKEEPTDPEAHRRSLQFVGVNGSISPRYESSSEDSSTAENFSDNESTENEAPE PEERVPS*547VAEAPQLRPKET*559AKAKTSREESQLPQESLHTPTAEGASGSSAKDEIRMELSPD LISACLALEKYLENPKALTERELKVAYTTVLQEWLRLACRSDAHPELVRRHLVTFRAMSA RLLDYVVNIADSNGNTALHYSVSHANFPVVQQLLDSGVCQVDKQNRAGYSPIMLTALATL KTQDDIQTILQLFRLGDVNAKASQAGQTALMLAVSHGRVDVVKALLACEADVNVQDDDGS TALMCACEHGHKEITALLLAVPSCDISITDRDGSTALMVALDAGHSEIASMLYSRMNIKC SFAPMSDDESPASSSAEE
Predicted Disorder Regions 303-370, 414-474, 500-573, 842-850
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments The Kank (kidney or KN motif and ankyrin repeat domain-containing) family of proteins has been described as essential for crosstalk between actin and microtubules.
Bibliography 1.Guo Q, Liao S, Zhu Z, Li Y, Li F, Xu C. Structural basis for the recognition of kinesin family member 21A (KIF21A) by the ankyrin domains of KANK1 and KANK2 proteins. J Biol Chem. 2018 Jan 12;293(2):557-566. doi: 10.1074/jbc.M117.817494. Epub 2017 Nov 28. PMID: 29183992; PMCID: PMC5767861. 2.Zhu Y, Kakinuma N, Wang Y, Kiyama R. Kank proteins: a new family of ankyrin-repeat domain-containing proteins. Biochim Biophys Acta. 2008 Feb;1780(2):128-33. doi: 10.1016/j.bbagen.2007.09.017. Epub 2007 Oct 4. PMID: 17996375. 3.Tadijan A, Samaržija I, Humphries JD, Humphries MJ, Ambriović-Ristov A. KANK family proteins in cancer. Int J Biochem Cell Biol. 2021 Feb;131:105903. doi: 10.1016/j.biocel.2020.105903. Epub 2020 Dec 10. PMID: 33309958.