Search by BoMiProt ID - Bomi6664


Primary Information

BoMiProt ID Bomi6664
Protein Name Kinesin-like protein KIF2A
Organism Bos taurus
Uniprot IdQ2NL05
Milk FractionWhey,exosome
Ref Sequence Id NP_001070541.1
Aminoacid Length 660
Molecular Weight 74994
Fasta Sequence https://www.uniprot.org/uniprot/Q2NL05.fasta
Gene Name KIF2A
Protein Existence Status reviewed

Secondary Information

Protein Function The interaction between Kif2A and AGAP1 complex contributes to control of cytoskeleton remodeling involved in cell movement.
Biochemical Properties Kif2A increased GAP activity of AGAP1, and a protein composed of the GLD and PH domains of AGAP1 increased ATPase activity of Kif2A. 
PTMs Acetylation and Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2NL05|KIF2A_BOVIN Kinesin-like protein KIF2A OS=Bos taurus OX=9913 GN=KIF2A PE=2 SV=1 MVTSLNEDNESVTVEWIENGDTKGKEIDLESIFSLNPDLVPDEDIEPS*48PET*51PPPPTSSAK VNKIVKNRRT*70VAS*73IKNEPPPRDNRVVGSARARPSQLPEQSSSAQQNARRKSNCVKEVEKL QEKREKRRLQQQELREKRAQDVDATNPNYEIMCMIRDFRGSLDYRPLTTADPIDEHRICV CVRKRPLNKKETQMKDLDVITIPSKDVVMVHEPKQKVDLTRYLENQTFRFDYAFDDSAPN EMVYRFTARPLVETIFERGMATCFAYGQTGSGKTHTMGGDFSGKNQDCSKGIYALAARDV FLMLKKPNYKKLELQVNATFFEIYSGKVFDLLNRKTKLRVLEDGKQQVQVVGLQEREVKC VEDVLKLIDIGNSCRTSGQTSANAHSSRSHAVFQIILRRKGKLHGKFSLIDLAGNERGAD TSSADRQTRLEGAEINKSLLAHKECIRALGRNKPHTPFRASKLTQVLRDSFIGENSRTCM IATISPGMASCENTLNTLRYANRVKELTVDPTAAGDVRPIMHHPPNQIDDLEAQWGVGSS PQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVEDHRAVFQESIRWLEDEKALL EMTEEVDYDVDSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL
Predicted Disorder Regions 9-47, 63-115,
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Kinesin-13s are regulated by both phosphorylation and direct protein interactions. During mitosis, phosphorylation of the N-terminal domain of Kif2A and Kif2C by aurora B inhibits activity, whereas Plk1 phosphorylation promotes Kif2B function. Phosphorylation of the motor domain of the Drosophila kinesin-13 KLP10 by casein kinase inhibits activity.
Bibliography Luo R, Chen PW, Wagenbach M, Jian X, Jenkins L, Wordeman L, Randazzo PA. Direct Functional Interaction of the Kinesin-13 Family Member Kinesin-like Protein 2A (Kif2A) and Arf GAP with GTP-binding Protein-like, Ankyrin Repeats and PH Domains1 (AGAP1). J Biol Chem. 2016 Oct 7;291(41):21350-21362. doi: 10.1074/jbc.M116.732479. Epub 2016 Aug 16. Erratum in: J Biol Chem. 2016 Dec 2;291(49):25761. PMID: 27531749; PMCID: PMC5076806. 2.Knowlton, A. L., Vorozhko, V. V., Lan, W. J., Gorbsky, G. J., and Stukenberg, P. T. (2009) ICIS and Aurora B Coregulate the Microtubule Depolymerase Kif2a. Curr Biol 19, 758-763. 3.Andrews, P. D., Ovechkina, Y., Morrice, N., Wagenbach, M., Duncan, K., Wordeman, L., and Swedlow, J. R. (2004) Aurora B regulates MCAK at the mitotic centromere. Dev Cell 6, 253-268. 3. Hood, E. A., Kettenbach, A. N., Gerber, S. A., and Compton, D. A. (2012) Plk1 regulates the kinesin-13 protein Kif2b to promote faithful chromosome segregation. Mol Biol Cell 23, 2264-2274.