Search by BoMiProt ID - Bomi6663


Primary Information

BoMiProt ID Bomi6663
Protein Name Kinesin-like protein KIF22
Organism Bos taurus
Uniprot IdA6QPL4
Milk FractionWhey,exosome
Ref Sequence Id NP_001095338.2
Aminoacid Length 662
Molecular Weight 73202
Fasta Sequence https://www.uniprot.org/uniprot/A6QPL4.fasta
Gene Name KIF22
Gene Id 506294
Protein Existence Status Reviewed

Secondary Information

Protein Function It is a kinesin family member that is involved in spindle formation and the movements of chromosomes during mitosis and meiosis. It binds to microtubules and to DNA and also has a role in congression of laterally attached chromosomes in NDC80-depleted cells.
PTMs Phosphorylation and Ubiquitinylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QPL4|KIF22_BOVIN Kinesin-like protein KIF22 OS=Bos taurus OX=9913 GN=KIF22 PE=2 SV=2 MDAGLPARRRREMAAAISGAGRCRLSKVGAGRRPPPARVRVAVRLRPFVDGTAGENDTPC VRGLDSCSLEIANWRNHQETLKYQFDAFYGERSSQQDIYAGSVQPILRHLLEGQNASVLA YGPTGAGKTHTMLGSPEQPGVIPRALMDLLQLTREEGAEGRPWALSVTMSYLEIYQEKVL DLLEPSSGDLVIREDCRGNILIPGLTQKPITSFADFERHFLPASRNRTVGATRLNQRSSR SHAVLLVKVDQRERLAPFRQREGKLYLIDLAGSEDNRRTGNKGLRLKESGAINTSLFVLG KVVDALNQGLPRVPYRDSKLTRLLQDSLGGSAHSILIANIAPERRFYLDTVSALNFAARS KEVINRPFTNESLQLPVLAPVKLSQKELLGPSEAKRARGPEEEETES*407PELPIAPASASQK LS*422PLQKLSSMDPAMLERLLSLDRLLGS*447QGSQGTPLLSTPKRERMVLMKTVEEKDLEIERL KMKQKELEAKVLAQEAADPKEKENYSTTMLRPLARRTVTVAKPLKKAVVMPLQLIQEQAA S*541PNAKIHILKKKGRKRKLES*560LDASQPEKAEDGWELQIS*578PELLAHGRQKILDLLNEGSARD LRSLQRIGQKKAQLIVGWRELHGPFSQVEDLERVEGISGKQMESFLKANILGLAAGQGCG PS
Predicted Disorder Regions 1-34, 401-425, 517-524, 544-562
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Ubiquitination is brought about by SIAH1 which leads to its subsequent proteasomal degradation.
Bibliography Zhang, Z., Xie, H., Zhu, S., Chen, X., Yu, J., Shen, T., Li, X., Shang, Z., & Niu, Y. (2018). High Expression of KIF22/Kinesin-Like DNA Binding Protein (Kid) as a Poor Prognostic Factor in Prostate Cancer Patients. Medical science monitor : international medical journal of experimental and clinical research, 24, 8190–8197. https://doi.org/10.12659/MSM.912643