Search by BoMiProt ID - Bomi6661


Primary Information

BoMiProt ID Bomi6661
Protein Name Kinesin-like protein KIF20A
Organism Bos taurus
Uniprot IdQ29RT6
Milk FractionWhey,exosome
Ref Sequence Id NP_001039753.1
Aminoacid Length 888
Molecular Weight 100044
Fasta Sequence https://www.uniprot.org/uniprot/Q29RT6.fasta
Gene Name KIF20A
Gene Id 527854
Protein Existence Status reviewed

Secondary Information

Protein Function participates in microtubule bundling.stimulates the polarized accumulation of RhoA,which is required for furrow formation and stable ingression at the equatorial cortex.
Biochemical Properties a globular N-terminal motor domain which mediates the motor activity,a central coiled coil domain,containing Rab6 and Myosin II binding domains which is essential for dimerization and a C-terminal tail domain which contributes to vesicle transport and interactions with partner proteins.The stalk domain and C-terminal tail domain of KIF20A are required for microtubule binding, higher-order complex formation and chromosome binding.Binding of KIF20A to Plk1 is regulated by its phosphorylation at EHS528LQV and Plk1 binds to phosphorylated KIF20A through its polo-box domain.
PTMs Phosphorylation and acetylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29RT6|KI20A_BOVIN Kinesin-like protein KIF20A OS=Bos taurus OX=9913 GN=KIF20A PE=2 SV=1 MSQGILS*7PPAGLLS*14DEEVVVS*21PMFESTAADLGSVIRKDLLSDCSVISTSLEDKQVPSEDG TEKVKVYLRVRPLLPSELERQEDQGCVCIENMETLALQAPKDSFAQKSNERGIGQATHRF TFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTYTIQGTIKDGGILP RSLALIFNSLQGQLHPTPNLKPLFSNEVMWLDSKQIRQEELKKLALLNGGLQEEELSTSL KKSVYIDSRMGTSTSFDSGIAGLSSSSQFPSSSQLDEMSHRWAQPDTVPVSVPADLRFSI WISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQDAEEAWKLLKV GRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIIPKISELSLCDLAGSERCKDQKSG ERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLVPFRDSKLTRVFQGFFTGRGRSCMI VNVNPCASTYDETLHVAKFSAIASQLVHAPPVQLGFPSIHSFLKEHS*527LRAS*531PSLETGAKT DPGLGDDIENEVDISTYGKEELLQVVEAMKALLLKERQEKLRLEVQLRDEICNEMVEQMQ QREQWCSEHLDTQKELLEELYEDKLTILKESLTSFYQEELQERDEKIKELEALLQEARQQ QVAHQPS*667GSELSLRRSQRLTSVS*683TQQFHEIKAKLEQCKAELNSTTEELQKYQKMLEPPPS AKPFIVDVDKKLEEGQKNIRLLRTELQKLGESLQSAERACCHNTGAGKLRQALATCDDIL IKQDQTLAELQNNMTLVKLDLRKKAACIAEQYHTVLKLQGQAS*823TKKRLGANQENQQPNQQ PPGKKPFLRNLLPRT*855PTCQSSTDCS*865PYARILRSRRS*876PLLKS*881GPFGKKY
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation prevents premature release of KIF20A and advanced complex formation, which ensures normal cell cycle progression.Phosphorylated by PLK1 at Ser-527 during mitosis, creating a docking site for PLK1 and recruiting PLK1 at central spindle.At the late stage of mitosis, Cdk1/cyclin B1 activity is decreased, and KIF20A is dephosphorylated and released. Aurora B phosphorylates KIF20A in late anaphase when together with CPC,KIF20A form a complex to locate at the cleavage furrow, and promote cleavage furrow formation.
Bibliography 1.Wu WD, Yu KW, Zhong N, Xiao Y, She ZY. Roles and mechanisms of Kinesin-6 KIF20A in spindle organization during cell division. Eur J Cell Biol. 2019 Jun;98(2-4):74-80. doi: 10.1016/j.ejcb.2018.12.002. Epub 2018 Dec 16. PMID: 30579662.