Search by BoMiProt ID - Bomi6649


Primary Information

BoMiProt ID Bomi6649
Protein Name Kinesin light chain 3
Organism Bos taurus
Uniprot IdQ2TBQ9
Milk Fractionwhey
Ref Sequence Id NP_001033638.1
Aminoacid Length 505
Molecular Weight 55583
Fasta Sequence https://www.uniprot.org/uniprot/Q2TBQ9.fasta
Gene Name KLC3
Gene Id 517633
Protein Existence Status Reviewed

Secondary Information

Protein Function Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus OX=9913 GN=KLC3 PE=2 SV=1 MSVQVAAPGGLGLGLERPSPEELVRQTRQVVKGLEALRAEHRGLAGHLAEALAAQGPAAG LELLEEKQQVVSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRAQARRLAQENAWLR EELEETQRRLRASEEAVAQLEEEKSHLEFLGQLRQYDPPAESQQPESPPRRDS*173LASLFPS EEEERRGPEAVGAAAAQQGGYEIPARLRTLHNLVIQYAGQGRYEVAVPLCRQALEDLERS SGHCHPDVATMLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL YGKRGRYREAEPLCQRALEIREKVLGADHPDVAKQLNNLALLCQNQGKFEEVERHYARAL SIYEALGGPHDPNVAKTKNNLASAYLKQNKYQQAEELYKEILHREALPAPLGAPNTGTTS DTQQQTLSRSSSFSKLRESIRRGSEKLVSRLRGEGAAGAAGMKRAMS*467LSMLNTDGSRAPE NQFPRQHLSEASRTLSTST*499QDLGPR
Predicted Disorder Regions 8-20, 141-175, 483-504
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Zhang, Y., Oko, R., & van der Hoorn, F. A. (2004). Rat kinesin light chain 3 associates with spermatid mitochondria. Developmental biology, 275(1), 23–33. https://doi.org/10.1016/j.ydbio.2004.07.014