Search by BoMiProt ID - Bomi6619


Primary Information

BoMiProt ID Bomi6619
Protein Name KICSTOR complex protein ITFG2/Adrenal medulla 50 kDa protein/Integrin-alpha FG-GAP repeat-containing protein 2
Organism Bos taurus
Uniprot IdQ27969
Milk FractionWhey
Ref Sequence Id NP_776987.1
Aminoacid Length 532
Molecular Weight 58160
Fasta Sequence https://www.uniprot.org/uniprot/Q27969.fasta
Gene Name ITFG2/ADP50
Gene Id 282275
Protein Existence Status reviewed

Secondary Information

Protein Function recruits GATOR1 to the lysosome and is necessary for nutrients to regulate mTORC1
Biochemical Properties strong interaction between KICSTOR and GATOR1, which is an inhibitor of the Rag GTPases indicates that KICSTOR might be required for the control of the mTORC1 pathway by amino acids
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q27969|ITFG2_BOVIN KICSTOR complex protein ITFG2 OS=Bos taurus OX=9913 GN=ITFG2 PE=2 SV=1 MRSVSYVQRVALEFSGSLFPHAICLGDVDNDTLNELVVGDTSGKLSVYKNDDSRPWLTCS CQGMLTCVGVGDVCNKGKNLVVAVSAEGWFHLCDLTPAKSLDGS*104GHHETLGGEEQRPVFK QHIPANTKVMLISDIDGDGRCELVVGYTDRVVRAFRWEDLGEGAEHPMGQLVLLKKWMLE GQVDSLSVTPGPLGVPELMVSQPGCAYAILLCTWNKDPGATPTSEGPMEGHSGAPGCPGR CVAPDLWPHPQQERLHSPHRQHQASHSPDSSASGLFALCTLDGTLKLMEEADRLLWSVQV DHQLFALEKLDVTGNGHEEVVACAWDGQTYIIDHNRTVVRFQVDENIRAFCAGLYACKDS RNSPCLVYVTFNQKIYVYWEVQLERMESTNLLKVLEAQPSSGSCWESWAWILMSCPPPAP CFTKPSTIQTSLHSAPPRAPRTPPSWTGFLAEQGAFCTSPPPPPPQLSGIWKTGSAHYWG RMAAPLGCGDCRPPGRLGEGRDKLPLCPFPCVPHLSRQQALPLPRAPYSCCL
Predicted Disorder Regions 218-270, 434-445, 459-461
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments KICSTOR complex composed of KPTN, ITFG2, KICS2 and SZT2. SZT2 probably serves as a link between the other three proteins in the KICSTOR complex and may mediate the direct interaction with the GATOR complex via GATOR1
Bibliography 1. Wolfson, Rachel L.; Chantranupong, Lynne; Wyant, Gregory A.; Gu, Xin; Orozco, Jose M.; Shen, Kuang; Condon, Kendall J.; Petri, Sabrina; Kedir, Jibril; Scaria, Sonia M.; Abu-Remaileh, Monther; Frankel, Wayne N.; Sabatini, David M. (2017). KICSTOR recruits GATOR1 to the lysosome and is necessary for nutrients to regulate mTORC1. Nature, 543(7645), 438–442.doi:10.1038/nature21423. 2.