Search by BoMiProt ID - Bomi661


Primary Information

BoMiProt ID Bomi661
Protein Name Platelet glycoprotein 4
Organism Bos taurus
Uniprot IdP26201
Milk FractionWhey, MFGM, Exosome
Ref Sequence Id NP_001265550.1
Aminoacid Length 472
Molecular Weight 52940
Fasta Sequence https://www.uniprot.org/uniprot/P26201.fasta
Gene Name CD36
Gene Id 281052
Protein Existence Status Reveiwed:Experimental evidence at protein level

Secondary Information

Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P26201|CD36_BOVIN Platelet glycoprotein 4 OS=Bos taurus OX=9913 GN=CD36 PE=1 SV=5
MGCNRNCGLIAGAVIGAVLAVFGGILMPVGDMLIEKTIKKEVVLEEGTIA FKNWVKTGTDVYRQFWIFDVQNPDEVTVN*79SSKIKVKQRGPYTYRVRYLAK EN*102ITQDPETHTVSFLQPNGAIFEPSLSVGTEDDTFTILNLAVAAAPQLYP NTFMQGILNSFIKKSKSSMFQN*172RTLKELLWGYTDPFLNLVPYPITTTIGV FYPYN*205NTADGIYKVFNGKDDISKVAIIDTYKGRKN*235LSYWSSYCDLIN*247GTD AASFPPFVEKTRVLQFFSSDICRSIYAVFGAEINLKGIPVYRFILPSFAF ASPFQNPDNHCFCTEKIISKN*321CTLYGVLDIGKCKEGKPVYISLPHFLHGS PELAEPIESLSPNEEEHSTYLDVEPITGFTLRFAKRLQVNMLVKPAKKIE ALKNLKHNYIVPILWLN*417ETGTIGDEKAEMFRNQVTGKINLLGLVEIVLLS VGVVMFIAFMISYCACRSKRVN
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 2TMHs; (7-29) & (440-462)