Search by BoMiProt ID - Bomi661


Primary Information

BoMiProt ID Bomi661
Protein Name Platelet glycoprotein 4
Organism Bos taurus
Uniprot IdP26201
Milk FractionWhey, MFGM, Exosome
Ref Sequence Id NP_001265550.1
Amino Acid Lenth 472
Molecular Weight 52940
Fasta Sequence https://www.uniprot.org/uniprot/P26201.fasta
Gene Name CD36
Gene Id 281052
Protein Existence Status Reveiwed:Experimental evidence at protein level

Secondry Information

Protein Function Serves as a ligand receptor of thrombospondin, long chain fatty acids, oxidized low density lipoproteins (LDLs) and malaria-infected erythrocytes; receptor for von Willebrand factor (vWF), which plays a crucial role in primary hemostasis;
Significance in milk Most abundant glycoprotein in buffalo MFGM; resposible for host immunity
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P26201|CD36_BOVIN Platelet glycoprotein 4 OS=Bos taurus OX=9913 GN=CD36 PE=1 SV=5
MGCNRNCGLIAGAVIGAVLAVFGGILMPVGDMLIEKTIKKEVVLEEGTIA FKNWVKTGTDVYRQFWIFDVQNPDEVTVN*79SSKIKVKQRGPYTYRVRYLAK EN*102ITQDPETHTVSFLQPNGAIFEPSLSVGTEDDTFTILNLAVAAAPQLYP NTFMQGILNSFIKKSKSSMFQN*172RTLKELLWGYTDPFLNLVPYPITTTIGV FYPYN*205NTADGIYKVFNGKDDISKVAIIDTYKGRKN*235LSYWSSYCDLIN*247GTD AASFPPFVEKTRVLQFFSSDICRSIYAVFGAEINLKGIPVYRFILPSFAF ASPFQNPDNHCFCTEKIISKN*321CTLYGVLDIGKCKEGKPVYISLPHFLHGS PELAEPIESLSPNEEEHSTYLDVEPITGFTLRFAKRLQVNMLVKPAKKIE ALKNLKHNYIVPILWLN*417ETGTIGDEKAEMFRNQVTGKINLLGLVEIVLLS VGVVMFIAFMISYCACRSKRVN
Bibliography 1. Hwangbo S, Azuma N, Kurisaki J, Kanno C. Purification and Characterization of Novel Whey Glycoprotein WGP-88 Which Binds to a Monoclonal Antibody to PAS-4 Glycoprotein in the Bovine Milk Fat Globule Membrane. Biosci Biotechnol Biochem. 1997;61(9):1568–74.
2. Nguyen HTH, Ong L, Hoque A, Kentish SE, Williamson N, Ang CS, et al. A proteomic characterization shows differences in the milk fat globule membrane of buffalo and bovine milk. Food Biosci. 2017 Sep 1;19:7–16.
3. Holmes RS. Comparative studies of vertebrate platelet glycoprotein 4 (CD36). Vol. 2, Biomolecules. MDPI AG; 2012. p. 389–414.