Search by BoMiProt ID - Bomi6600


Primary Information

BoMiProt ID Bomi6600
Protein Name Kelch-like protein 3
Organism Bos taurus
Uniprot IdF1MBP6
Milk FractionWhey
Ref Sequence Id XP_002689253.2
Aminoacid Length 587
Molecular Weight 64978
Fasta Sequence https://www.uniprot.org/uniprot/F1MBP6.fasta
Gene Name KLHL3
Gene Id 533364
Protein Existence Status reviewed

Secondary Information

Protein Function Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that acts as a regulator of ion transport in the distal nephron.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|F1MBP6|KLHL3_BOVIN Kelch-like protein 3 OS=Bos taurus OX=9913 GN=KLHL3 PE=3 SV=3 MDGESIKPSS*10QPLIQTGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVE IEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENV QVLLPAASLLQLMDVRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFP EVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLMEHVR LPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPLDQRLLIKNPRTKPRT*295PVSLP KVMIVVGGQAPKAIRSVECYDFEEDRWDQIAELPSRRCRAGVVFMAGHVYAVGGFNGSLR VRTVDVYDGVKDQWT*375S*376IASMQERRSTLGAAVLNDLLYAVGGFDGSTGLASVEAYSYKTNE WFFVAPMNTRRSS*433VGVGVVEGKLYAVGGYDGASRQCLSTVEQYNPATNEWTYVADMSTRR SGAGVGVLSGQLYATGGHDGPLVRKSVEVYDPGTNTWKQVADMNMCRRNAGVCAVNGLLY VVGGDDGSCNLASVEYYNPVTDKWTLLPTNMSTGRSYAGVAVIHKPL
Predicted Disorder Regions (1-27)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation at Ser-433 by PKA decreases the interaction with WNK4, Leading to inhibit WNK4 degradation by the BCR(KLHL3) complex. Phosphorylation at Ser-433 is increased by insulin.
Bibliography Zimin, A. V., Delcher, A. L., Florea, L., Kelley, D. R., Schatz, M. C., Puiu, D., Hanrahan, F., Pertea, G., Van Tassell, C. P., Sonstegard, T. S., Marçais, G., Roberts, M., Subramanian, P., Yorke, J. A., & Salzberg, S. L. (2009). A whole-genome assembly of the domestic cow, Bos taurus. Genome biology, 10(4), R42. https://doi.org/10.1186/gb-2009-10-4-r42