Search by BoMiProt ID - Bomi6557


Primary Information

BoMiProt ID Bomi6557
Protein Name Junctional protein associated with coronary artery disease homolog
Organism Bos taurus
Uniprot IdA2VE02
Milk FractionWhey
Ref Sequence Id NP_001075943.1
Aminoacid Length 1305
Molecular Weight 140176
Fasta Sequence https://www.uniprot.org/uniprot/A2VE02.fasta
Gene Name JCAD
Gene Id 784675
Protein Existence Status reviewed

Secondary Information

Protein Function endothelial, cell-cell junction protein.cell adhesion.positive regulation of vascular endothelial growth factor signaling pathway.
PTMs phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A2VE02|JCAD_BOVIN Junctional protein associated with coronary artery disease homolog OS=Bos taurus OX=9913 GN=JCAD PE=2 SV=1 MYSVEDLLISHGYKLSRKLPAPHEDDGERRQPARTTVPAGPGLLNGCDDGPAALPRGKAS PGTGLLSDPESRRLGPRGHGERPSTAAAARISEAGFYHQPVLAWSSQPLTGRSHAYWRRR EQEAREDPGGRGPVPSLPTHPREGPWEVGGRSEHVMKKAVWEDELGMAGPARWQDVSVRS WNQPPRLGRQMSDGVGEKLFQDLYPFMLGEHGLTSQSKGKSQSLPRVLSPESLSCMEVPI PLSDGHLPGVPKVPLQPPNCASNLESTRNPKKAGTSAPLPQPRFGRPLKPPSYGSQPHSK AGAENGSYTDSRQLDPGAAHSARTNSARQDLYGPDPGLEPPVYVPPPSYKSPPQPAAHPC PEEAVSRHEGRGRRVPQHPMERPAAGGQPLSGSRGAGSEWGASPCSPVGVPPQPHHTTAY DGSILIIPFDDPRIRHIKLPRPHGFWEDVKLDGAVPAPDPRSLQQEGAVWGPSGKERGPA PADPSPSWLWGQPPRNGENGSSPDQRDPCIVTQRKQPDVSGSPQEYPESLVSSPSPQGES SCEMQTQLRKFEAGLQPKRSSKKKTSETIFCLVSIPVKSESQLPGTDTNNNDLKQSASLQ EQSVLSLSSTDLELQALTGSMATRTELPRPDPGGPGRGRQADDLRFPSPAKHRALAWPGP WPGHHFRDQQTQTSFAHEPQSLQPLPGERPGGSPDPVLPPRCLDPAPFEVQMHMALASSD PNQRPGAHSPKSQGSLSPSSNSAFSGSSWPRNQGPVPRASLGQQGSDGPGRRASPVSRGE VIKGETTGPCNSRQLFGQFLLKPVSRRPWDLISQLESFNKELQEEEGSSGSSSDGSGSED S*841DTELPWGSCARPAPQLPGLLKDIVPEDPRTRPGRVKSKSESWSEEGRPRSPRPWQAEGR GSVWLSPPGSWIAEDGDREVEDRVAQLAVSPRPVKRAISSGLNDAKPEPPPDPAEQREPL PSQELPGSRGAVELSAAGPPRAGGGEQGSTRAPLSLAGKSRGLS*1004APDLRS*1010VGLTLVQEHS TSQLAGSPGDANAIEIPPNESLEARAARILGIEVAVESLLPGAQRAGQRRHPEPDGSALR PESPRQEAAASLAQPNESTAPADAFYGRRKCGWTKSPLFVGERDSTRQVPRASEPADVDG AVPTKAPETPPS*1152PLESQPFLPKDVETKPPFRSTLFHFIERTPNLAFSEKKLRNTSRVIES LQEKLVSPPRKADPDRLTRMKEVSSVSRMRLLTSRAADS*1239AEEPKAERGPGAWLGGLVAPS AGHKLSDPQGALSLEADGHPAARRENGGRDFWCPDSYDPSRVERV
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Shigeoka M, Arimoto S, Akashi M. JCAD expression and localization in human blood endothelial cells. Heliyon. 2020 Oct 8;6(10):e05121. doi: 10.1016/j.heliyon.2020.e05121. PMID: 33083606; PMCID: PMC7550929.