Primary Information |
|---|
| BoMiProt ID | Bomi6520 |
|---|
| Protein Name | Isochorismatase domain-containing protein 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A6QLY4 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001094683.1 |
|---|
| Aminoacid Length | 298 |
|---|
| Molecular Weight | 32116 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | ISOC1 |
|---|
| Gene ID | 540524 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | DNA damage repair and inflammation-related pathways |
|---|
| Biochemical Properties | can catalyze the transformation of isochorismate into 2,3-dihydroxy-2,3-dihydrobenzoate and pyruvate, with another substrate-water.298 amino acids long. |
|---|
| PTMs | Phosphorylation on Tyr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A6QLY4|ISOC1_BOVIN Isochorismatase domain-containing protein 1 OS=Bos taurus OX=9913 GN=ISOC1 PE=2 SV=1
MAAAEPAVPALPGGGGAGAGAPSGTVPVLFCFSVFARPAAVPHGAGYELLIQKFLSLYGD
QIDMHRKFVVQLFAEEWGQYVDLPKGFAVSERCKVRLVPLQIQLTTLGNLTPSSTVFFCC
DMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIVTEQY*160PKGLGSTVQEIDLTGVKLVL
PKTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGIEVHIVADATSSR
SMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
|
|---|
| Predicted Disorder Regions | 3 disordered segments; (1-6),(12-20), (292-298) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Shi J, Yang F, Zhou N, Jiang Y, Zhao Y, Zhu J, Prelaj A, Malhotra J, Normanno N, Danese E, Cardona AF, Hong X, Jiang G, Song X. Isochorismatase domain-containing protein 1 (ISOC1) participates in DNA damage repair and inflammation-related pathways to promote lung cancer development. Transl Lung Cancer Res. 2021 Mar;10(3):1444-1456. doi: 10.21037/tlcr-21-219. PMID: 33889521; PMCID: PMC8044495. |
|---|
