Search by BoMiProt ID - Bomi6520


Primary Information

BoMiProt ID Bomi6520
Protein Name Isochorismatase domain-containing protein 1
Organism Bos taurus
Uniprot IdA6QLY4
Milk FractionWhey
Ref Sequence Id NP_001094683.1
Aminoacid Length 298
Molecular Weight 32116
Fasta Sequence https://www.uniprot.org/uniprot/A6QLY4.fasta
Gene Name ISOC1
Gene Id 540524
Protein Existence Status reviewed

Secondary Information

Protein Function DNA damage repair and inflammation-related pathways 
Biochemical Properties can catalyze the transformation of isochorismate into 2,3-dihydroxy-2,3-dihydrobenzoate and pyruvate, with another substrate-water.298 amino acids long.
PTMs Phosphorylation on Tyr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QLY4|ISOC1_BOVIN Isochorismatase domain-containing protein 1 OS=Bos taurus OX=9913 GN=ISOC1 PE=2 SV=1 MAAAEPAVPALPGGGGAGAGAPSGTVPVLFCFSVFARPAAVPHGAGYELLIQKFLSLYGD QIDMHRKFVVQLFAEEWGQYVDLPKGFAVSERCKVRLVPLQIQLTTLGNLTPSSTVFFCC DMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIVTEQY*160PKGLGSTVQEIDLTGVKLVL PKTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGIEVHIVADATSSR SMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Predicted Disorder Regions 3 disordered segments; (1-6),(12-20), (292-298)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Shi J, Yang F, Zhou N, Jiang Y, Zhao Y, Zhu J, Prelaj A, Malhotra J, Normanno N, Danese E, Cardona AF, Hong X, Jiang G, Song X. Isochorismatase domain-containing protein 1 (ISOC1) participates in DNA damage repair and inflammation-related pathways to promote lung cancer development. Transl Lung Cancer Res. 2021 Mar;10(3):1444-1456. doi: 10.21037/tlcr-21-219. PMID: 33889521; PMCID: PMC8044495.