Search by BoMiProt ID - Bomi6495


Primary Information

BoMiProt ID Bomi6495
Protein Name Interphotoreceptor matrix proteoglycan 1/Mucin-like glycoprotein associated with photoreceptor cells/Sialoprotein associated with cones and rods
Organism Bos taurus
Uniprot IdQ9GMS5
Milk FractionWhey
Ref Sequence Id NP_776787.1
Aminoacid Length 794
Molecular Weight 89378
Fasta Sequence https://www.uniprot.org/uniprot/Q9GMS5.fasta
Gene Name IMPG1/MLGAPC
Gene Id 281866
Protein Existence Status reviewed

Secondary Information

Protein Function sialoprotein,expressed in both rod and cone photoreceptor cells. SPACR and hyaluronan may serve to form the basic macromolecular scaffold, which comprises the insoluble interphotoreceptor matrix.
Biochemical Properties have hyaluronan (HA) binding motifs of the receptor for HA-mediated motility (RHAMM) type. EGF-like domains require calcium for their biological function.EGF-like domain in IMPG1/SPACR contains the critical asparagine (Asn702), which has been implicated in calcium binding.
PTMs Highly glycosylated (N- and O-linked carbohydrates and sialic acid).Disulfide bond formation.
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q9GMS5|IMPG1_BOVIN Interphotoreceptor matrix proteoglycan 1 OS=Bos taurus OX=9913 GN=IMPG1 PE=2 SV=1 MHLEAARVIFFLWIFLQVQGIKDLSIKIYGSEIKDIDNAPRTEATKNTAKTYKVSTMRRI FDLAKHRTKRSAFFPTGVKVCPQESMEQILASLQAYYRLRVCQEAVWEAYRIFLDRLPEP GEYQDWVSVCQQETFCLFDIGKNFSNSQEHLDLLQQRMKQRNFLERKDEVVTKETLGELG QTPGLQQTLPVSHPGPCLSLPMTTAQRNPQLHPSRTPRVPTRERKIEFTDAAEDALEQKV ELSISLANQKFKSELDNSQSPYYLEVAAKSQLQMQKIFKKLPGFKEIHVSGFRPKKERDG TSSTEMQLTAIFKKGKAEAKSPASDPLSLDSNKIESEGDPRGTTEEEKQRELYPTASELR KLISRALEEDQSLDVGTIQFTDEIVGSLPSLDPDTQLVLPTLLTDITKDATLSPELPLGQ PRLET*425VDRAGHSPPGASPT*439DGWS*443PPAMT*448ST*450SLSETLPFFTASSVFPQTDQSATDIMSIDQTVLIPRLTVPTDDYSAISPLVPEISHLPTSSEDWLSTSSQDTMEYLDGVDLTKTPTSSEG PRNSVGMFPAWIIFLENITPDPGLRYITTSAMTVAARGRELVVFFSLRVANVPFSTDLFN KSSLEYQALEQRFTQLLVPNLRSN*624LTGFKQLEILNFRNGSVIVNSKVRFAKSVPYN*656LTKA VRGVLEDFRSTAAQQLDLEIDSYSLDVEPADQADPCKFLACGEFAQCVRNEWTEEAECRC RSGTQALVLPIEDCEDIPGKGTPCRSLDQSKNQVYEPGVKKFQRQQDNKVTMKRKFELLT IGYEEFNYQDWEGN
Predicted Disorder Regions 166-223, 298-302, 316-325, 344-473, 503-542
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Seven potential N-linked glycosylation sites are present in two clusters on either side of a mucin-like domain containing potentialO-linked glycosylation sites (from residue Gly296 to Pro552).The six conserved cysteine residues present in EGF like domain are involved in intrachain disulfide bonding that is required for the structural stability .
Bibliography 1.Acharya S, Rodriguez IR, Moreira EF, Midura RJ, Misono K, Todres E, Hollyfield JG. SPACR, a novel interphotoreceptor matrix glycoprotein in human retina that interacts with hyaluronan. J Biol Chem. 1998 Nov 20;273(47):31599-606. doi: 10.1074/jbc.273.47.31599. PMID: 9813076. 2.Brandl C, Schulz HL, Charbel Issa P, Birtel J, Bergholz R, Lange C, Dahlke C, Zobor D, Weber BHF, Stöhr H. Mutations in the Genes for Interphotoreceptor Matrix Proteoglycans, IMPG1 and IMPG2, in Patients with Vitelliform Macular Lesions. Genes (Basel). 2017 Jun 23;8(7):170. doi: 10.3390/genes8070170. PMID: 28644393; PMCID: PMC5541303.