Search by BoMiProt ID - Bomi6494


Primary Information

BoMiProt ID Bomi6494
Protein Name Interleukin-4/B-cell stimulatory factor 1/Lymphocyte stimulatory factor 1
Organism Bos taurus
Uniprot IdP30367
Milk FractionWhey
Ref Sequence Id NP_776346.1
Aminoacid Length 135
Molecular Weight 15119
Fasta Sequence https://www.uniprot.org/uniprot/P30367.fasta
Gene Name IL4
Gene Id 280824
Protein Existence Status reviewed

Secondary Information

Protein Function role in B-cell activation and maturation step.regulation of B cell growth and of antibody isotype expression. Stimulation of T cell growth and the generation of cytotoxic T lymphocytes.Regulation of the growth and differentiation of hematopoietic bone marrow stem cells.
Significance in milk oncentration of IL-4 has been found significantly lower both in serum and in milk of cows with staphylococcal mastitis .
PTMs Disulfide bond formation, Glycosylation,proteolytic cleavage.
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P30367|IL4_BOVIN Interleukin-4 OS=Bos taurus OX=9913 GN=IL4 PE=2 SV=2 MGLTSQLIPVLVCLLVCTSHFVHGHKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAP KN*62TTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDL LERLKTIMKEKYSKC
Predicted Disorder Regions 125-135
DisProt Annotation
TM Helix Prediction no TM helices
Significance of PTMs The protein contains two (human) or three (murine) N-glycosilation sites, yielding a glycoprotein with a molecular mass of 20 kD that is reduced to 15 kD after deglycosylation .Removal of the N-linked glycosidic side chains does not abrogate the bioactivity of the protein.A sequence encoding a hydrophobic stretch of peptide precedes the sequence coding for the mature protein. This putative signal peptide is cleaved from the protein before secretion.
Bibliography 1.Bochniarz M, Zdzisińska B, Wawron W, Szczubiał M, Dąbrowski R. Milk and serum IL-4, IL-6, IL-10, and amyloid A concentrations in cows with subclinical mastitis caused by coagulase-negative staphylococci. J Dairy Sci. 2017 Dec;100(12):9674-9680. doi: 10.3168/jds.2017-13552. Epub 2017 Sep 28. PMID: 28964518. 2.Jansen JH, Fibbe WE, Willemze R, Kluin-Nelemans JC. Interleukin-4. A regulatory protein. Blut. 1990 May;60(5):269-74. doi: 10.1007/BF01736226. PMID: 2190652.