Search by BoMiProt ID - Bomi6492


Primary Information

BoMiProt ID Bomi6492
Protein Name Interleukin-2 receptor subunit alpha/IL-2 receptor subunit alpha/IL-2-RA/IL-2R subunit alpha/IL2-RA/TAC antigen/p55/CD_antigen: CD25
Organism Bos taurus
Uniprot IdP12342
Milk FractionWhey
Ref Sequence Id NP_776783.1
Aminoacid Length 275
Molecular Weight 31239
Fasta Sequence https://www.uniprot.org/uniprot/P12342.fasta
Gene Name IL2RA
Gene Id 281861
Protein Existence Status reviewed

Secondary Information

Protein Function Receptor for interleukin-2.regulation of T cells.It acts as major growth factor for activated T-lymphocytes and stimulates clonal expansion and maturation of these lymphocytes.
Biochemical Properties mouse IL2RA is 55kD.composed of N- and C-terminal fibronectin-III domains (D1 and D2, respectively), which are characterized by a β-sandwich sheet consisting of seven antiparallel strands arranged in a three-on-four topology. In IL-2Rβ, the D1 and D2 domains are connected by a helical linker and are bent at ∼90°.The two prominent hydrophobic ridges around residues Phe42 and Tyr45 of IL-2 insert into grooves between the IL-2Rα beta strands.
Significance in milk involved in the intracellular signaling pathways
PTMs Glycosylation and disulfide bond formation.
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P12342|IL2RA_BOVIN Interleukin-2 receptor subunit alpha OS=Bos taurus OX=9913 GN=IL2RA PE=2 SV=1 MEPSLLMWRFFVFIVVPGCVTEACHDDPPSLRNAMFKVFRYEVGTMINCDCKTGFRRVSA VMRCVGDSSHSAWENRCFCN*80STSPAKNQVKQVTPAPEEHREKKHTDAQN*109QTQPPEEADLP GHCEEPPPWEHEREPLKRVYHFTLGQTVHYQCAQGFRALQTSPAESTCMMINGELRWTRP RLKCIREGEHGQASDDAEPQESTEAPPGSGTFLPTRMAGTTNFQKPTDEIATLDTFIFTT EYQIAVAGCTLLLASILLLSCLTWQRKWKKNRRTI
Predicted Disorder Regions 82-137, 184-226
DisProt Annotation
TM Helix Prediction 1TMH; (242-264)
Bibliography 1.Kuhn DJ, Dou QP. The role of interleukin-2 receptor alpha in cancer. Front Biosci. 2005 May 1;10:1462-74. doi: 10.2741/1631. PMID: 15769637. 2.Wang X, Rickert M, Garcia KC. Structure of the quaternary complex of interleukin-2 with its alpha, beta, and gammac receptors. Science. 2005 Nov 18;310(5751):1159-63. doi: 10.1126/science.1117893. PMID: 16293754.