Search by BoMiProt ID - Bomi6491


Primary Information

BoMiProt ID Bomi6491
Protein Name Interleukin-17A
Organism Bos taurus
Uniprot IdQ687Y7
Milk FractionWhey
Ref Sequence Id NP_001008412.1
Aminoacid Length 153
Molecular Weight 17242
Fasta Sequence https://www.uniprot.org/uniprot/Q687Y7.fasta
Gene Name IL17A
Gene Id 282863
Protein Existence Status reviewed

Secondary Information

Protein Function cytokine activity,inflammation,host defense
Biochemical Properties highly conserved C-terminus containing a cysteine-knot fold structure 
Significance in milk Act as biomarker for Bovine Tuberculosis
PTMs Disulfide bond formation,Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q687Y7|IL17_BOVIN Interleukin-17A OS=Bos taurus OX=9913 GN=IL17A PE=2 SV=1 MASMRTSSMSLLLLLSLVALVKAGVIIPQSPGCPPTEDKNFPQHVRVNLNIVN*53RSTNSRR PTDYHKRSTSPWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVL RRESQHCPHSFRLEKMLVAVGCTCVTPIVRHLA
Predicted Disorder Regions 3 disordered segments; (1-6), (29-44), (50-73)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Chen K, Kolls JK. Interluekin-17A (IL17A). Gene. 2017 May 30;614:8-14. doi: 10.1016/j.gene.2017.01.016. Epub 2017 Jan 22. PMID: 28122268; PMCID: PMC5394985.