Search by BoMiProt ID - Bomi6464


Primary Information

BoMiProt ID Bomi6464
Protein Name Interferon regulatory factor 3
Organism Bos taurus
Uniprot IdQ4JF28
Milk FractionWhey,MFGM
Ref Sequence Id NP_001025016.1
Aminoacid Length 417
Molecular Weight 46646
Fasta Sequence https://www.uniprot.org/uniprot/Q4JF28.fasta
Gene Name IRF3
Gene Id 516979
Protein Existence Status reviewed

Secondary Information

Protein Function Interferon regulatory factor (IRF) 3 plays a key role in innate responses against viruses. Indeed, activation of this transcription factor triggers the expression of type I interferons and downstream interferon-stimulated genes in infected cells
Biochemical Properties IRF3 was found to be a major component of the “MyD88-independent” pathway triggered downstream of TLR4 in response to lipopolysaccharide (LPS).C-terminal domain of IRF-3 located between aa 380 and 427 participates in the autoinhibition of IRF-3 activity via an intramolecular association with the N-terminal region between aa 98 and 240.
PTMs Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q4JF28|IRF3_BOVIN Interferon regulatory factor 3 OS=Bos taurus OX=9913 GN=IRF3 PE=2 SV=1 MGT*3QKPRILPWLIS*14QLDRGELEGVAWLGESRTRFRIPWKHGLRQDAQQEDFGIFQAWAVA SGAYT*75PGKDKPDLPTWKRNFRSALNRKEVLRLAEDHS*97KDSQDPHKIYEFVNSGVRDIPEP DTS*123QDNGRHNTSDTQEDTLEKLLSDMDLSPGGPSNLTMASEKPPQFLQSPDSDIPALCPN SGLS*184ENPLKQLLANEEDWEFEVTAFYRGCQVFQQTVFCPGGLRLVGSEAGDRMLPGQPIR LPDPATSLT*249DKSVTDYVQRVLSCLGGGLALWRAGQWLCAQRLGHCHVYWAIGEELLPSCG HKPDGEVPKDREGGVFNLGPFITDLITFIEGSRRSPLYTLWFCVGQSWPQDQPWIKRLVM VKVVPMCLRVLVDIARQGGAS*381S*382LENTVDLHIS*392NS*394DPLSLT*400PDQYMACLQDLAEDMDF
Predicted Disorder Regions 66-77, 95-184, 237-245
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Carboxy-terminal phosphorylation of serine residues located in the regulatory domain of IRF3 allows homo- and heterodimerization, nuclear translocation and association with chromatin modifiers such as CREB-binding protein (CBP) and p300 to promote the transcription of its target genes.Virus-induced phosphorylation of IRF-3 leads to cytoplasmic to nuclear translocation of phosphorylated IRF-3, association with the transcriptional coactivator CBP/p300, and stimulation of DNA binding and transcriptional activities of virus-inducible genes.
Bibliography 1.Ysebrant de Lendonck L, Martinet V, Goriely S. Interferon regulatory factor 3 in adaptive immune responses. Cell Mol Life Sci. 2014 Oct;71(20):3873-83. doi: 10.1007/s00018-014-1653-9. Epub 2014 May 31. PMID: 24879293.