Search by BoMiProt ID - Bomi6451


Primary Information

BoMiProt ID Bomi6451
Protein Name Inter-alpha-trypsin inhibitor heavy chain H5/ITI heavy chain H5/ITI-HC5/Inter-alpha-inhibitor heavy chain 5
Organism Bos taurus
Uniprot IdA2VE29
Milk FractionWhey
Ref Sequence Id NP_001095986.1
Aminoacid Length 940
Molecular Weight 104356
Fasta Sequence https://www.uniprot.org/uniprot/A2VE29.fasta
Gene Name ITIH5
Gene Id 534787
Protein Existence Status reviewed

Secondary Information

Protein Function Interacts with HA(Hyaluronan),participate in ECM stabilization and epidermal differentiation,also modulating epidermal differentiation.
PTMs Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A2VE29|ITIH5_BOVIN Inter-alpha-trypsin inhibitor heavy chain H5 OS=Bos taurus OX=9913 GN=ITIH5 PE=2 SV=1 MLPLLGLCFALPLCAGLLEEARSWEDTSDQVGLRIPRQVRLLQRLKTKPLMTEFSVKSTI ISRYAFTTVACRMLNRGSEDQEVTFQMQIPAAAFITN*97FTALIGDKVYQGEITEREKRNGD KVKEKRN*127KTIEDNGEKGTETFRASAVLPSKDKAAFLLSYEELLQRRLGKYEHVVSVRPQQ LVGRLTVEVTVLERPGIAELEVLGLQNSRQRGSGRGPDDSGPPPSTVINQN*231ETFAKVVFK PSVVQQAKIAQNGILGDFIVRYDVNREQSIGDIQVLDGYFVHYFAPKDLPPLPKNVVFVL DSSASMVGTKLRQTKDALFTILHDLRPQDHFNIVGFSNRIKVWKDHLVSVTPNSIRDGKV YIHHMSPSGGTDINGALQRGIQLLNDYVAHNDIEDRSVSLVVFLTDGKPTVGETHTFKIL N*421NTREATRGRVCIFTVGIGADVDFKLLEKLSLENCGLTRRVHEDHDARAQLIGFYDEIRT PLLSDIRVDYPPSLVERATRTLFPNYFN*508GSEIVIAGKLVDRAMDRLHVEVTASNSKKFVV LKKDVPVEPRKVGIDVSQSPRPRGRGQEEPNHLERLWSYLTLKELLSAWLQSIEEPERER LRQEAQALAVNHHFLIPFTSMTLKSAPRTEAPEAAYGMSSTSMATGPETVMQSLRGTHLQ PGPAVKKPYNPRIKISKTSADGDPHFVVDFPLSN*694LTVCFNIDGEPGHILRLVSDHADSGV TVNGELIGAPAPPNGHKKQRTYFRTITILVNKPERSYLEITPSRVIVDGGDRLVLPCN*778QS AVVGRRGLEVSVSAN*795ASVTISIQGTVAFVVLLHLYKKPAPYQRNHLGFYIANGQGLSSNC HGLLGQFLNQEARLIGLSKSPAHPPVPEAGERSEAVLEVKGRQVPVVWKQRRIYNGEEQV DCWFARNNAAGLIDGEYKGYLAAHPFDSETAFGPGLSQGL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Huth S, Huth L, Marquardt Y, Fietkau K, Dahl E, Esser PR, Martin SF, Heise R, Merk HF, Baron JM. Inter-α-Trypsin Inhibitor Heavy Chain 5 (ITIH5) Is a Natural Stabilizer of Hyaluronan That Modulates Biological Processes in the Skin. Skin Pharmacol Physiol. 2020;33(4):198-206. doi: 10.1159/000509371. Epub 2020 Aug 14. PMID: 32799206.