Search by BoMiProt ID - Bomi6449


Primary Information

BoMiProt ID Bomi6449
Protein Name Inter-alpha-trypsin inhibitor heavy chain H3/ ITI heavy chain H3/ITI-HC3/Inter-alpha-inhibitor heavy chain 3
Organism Bos taurus
Uniprot IdP56652
Milk FractionWhey
Ref Sequence Id NP_001095368.1
Aminoacid Length 891
Molecular Weight 99551
Fasta Sequence https://www.uniprot.org/uniprot/P56652.fasta
Gene Name ITIH3
Gene Id 508355
Protein Existence Status reviewed

Secondary Information

Protein Function Serves as Novel Diagnostic Biomarkers in Human Colorectal Cancer
Biochemical Properties ITI is a glycoprotein composed of three polypeptides: two heavy chains (HC1 and HC2) and one light chain (bikunin).Unlike the majority of plasma protein a non-disulfide covalent linkage exists between heavy chains and bikunin.
Significance in milk an acute phase protein
PTMs N-linked glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P56652|ITIH3_BOVIN Inter-alpha-trypsin inhibitor heavy chain H3 OS=Bos taurus OX=9913 GN=ITIH3 PE=1 SV=2 MALAQWPYLILALLSGLAVSGFPRNPSLLLGKRSLPGRAVDGIEVYSTKVNCKVTSRFAH NVVTTRAVNHANTAKEVSFDVELPKTAFITN*91FTLTIDGVTYPGKVKEKEVAKKQYEKAVS QGKTAGLVKASGRKLEKFTVSVNVAAGSKVTFELTYEELLKRHKGKYEMYLKVQPKQLVK HFEITVDIFEPQGISTLDAEASFITNDLLGSALTKSFSGKKGHVSFKPSLDQQRSCPTCT DSLLKGDFIITYDVNRESPANVQIVNGYFVHFFAPQGLPVVPKSVVFVIDVSGSMHGRKM EQTKDALLKILEDVKQDDYLNFILFSGDVTTWKDSLVPATPENIQEASKFVMDIQDRGMT NINDALLRGISMLNKAREEHTVPERSTSIIIMLTDGDANVGESRPEKIQENVRNAIGGKF PLYNLGFGNNLNYNFLENMALENHGLARRIYEDSDANLQLQGFYEEVANPLLTGVEVEYP QNAILDLTQNSYQHFYDGSEIVVAGRLADEDMNSFKAAVKGHGAINDLTFTEEVDMKEME KALQERDYIFGDYIERLWAYLTIEQLLDKRKNAQGEEKEILTAQALELSLKYHFVTPLTS MVVTKPEDNENQTAIANKPGEGPLDAEEVPSMAYLTSYQAPQTPYYYVDGDPHFIIQIPE KDDAICFNIDEDPGTVLRLIQDPVTGLTVNGQIIGEKTGRSDSQTRRTYFGKLGIASAQM DFRIEVTRENITLWNGDSLSTFSWLDTVMVTQDGLSVMINRKKNMVVSFGDGVTFVVVLH QVWKKEPAHHDFLGFYVVNSRGMSAQTHGLLGQFFHPFDFQVSDVHPGSDPTKPDATMVV KNHQLTVTRGSQKDYRKDISVGRNVACWFVHNNGQGLIDGIHRDYIVPNLF
Predicted Disorder Regions 611-624, 828-835
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs The glycosylated form of the bikunin corresponds to the urinary trypsin inhibitor (UTI), an ITI derivative.
Additional Comments ITI-related proteins might be considered as HA-binding proteins (HABP). The ITI related proteins are composed of four polypeptides (HC1, HC2, HC3 and the bikunin) encoded by four genes H1, H2, H3 and L.
Bibliography 1.Jiang X, Bai XY, Li B, Li Y, Xia K, Wang M, Li S, Wu H. Plasma Inter-Alpha-Trypsin Inhibitor Heavy Chains H3 and H4 Serve as Novel Diagnostic Biomarkers in Human Colorectal Cancer. Dis Markers. 2019 Jul 31;2019:5069614. doi: 10.1155/2019/5069614. PMID: 31481982; PMCID: PMC6701429. 2.Bost F, Diarra-Mehrpour M, Martin JP. Inter-alpha-trypsin inhibitor proteoglycan family--a group of proteins binding and stabilizing the extracellular matrix. Eur J Biochem. 1998 Mar 15;252(3):339-46. doi: 10.1046/j.1432-1327.1998.2520339.x. PMID: 9546647.