Search by BoMiProt ID - Bomi6439


Primary Information

BoMiProt ID Bomi6439
Protein Name Integrin beta-5
Organism Bos taurus
Uniprot IdP80747
Milk FractionWhey
Aminoacid Length 800
Molecular Weight 88057
Fasta Sequence https://www.uniprot.org/uniprot/P80747.fasta
Gene Name ITGB5
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells Endothelial cells
Protein Function cell to ECM attachment.binds to fibronectin at RGD sequence
PTMs phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P80747|ITB5_BOVIN Integrin beta-5 OS=Bos taurus OX=9913 GN=ITGB5 PE=1 SV=2 MPRAPALLFSCLLGLCALVPRLPGLNICTSGSATSCEECLLIHPKCAWCFKEDFGSLRSV TSRCDLKANLIRNGCGVEFESPASSTQVLRSLPLSSKGSSPAGSDVIQLTPQEVTVTLRP GDRTAFQLQVRQVEDYPVDLYYLMDLSLSMKDDLENIRSLGTKLAEEMRKLTSNFRLGFG SFVDKNISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKN*347FTALIPGTTVEIL HGDSKNILQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD TASFEVSVEARSCPSKHVQHTFTLRPVGFRDSLEVGVTYNCRCGCSAGLEPDSARCSSN*479G TYVCGLCECNPGYLGTRCECQEGESQSGYQNLCREAEGKPLCSGRGQCSCNQCSCFESEF GKIYGSFCECDN*552FSCARNKGVLCSGHGECHCGECKCHAGYIGDNCN*586CSTDISTCQARDGH ICSDRGHCVCGQCQCTEPGAFGETCEKCPTCPDACSTKRDCVECLLLHSGSSADN*655QTCQN LCKDEVITRVDTIVKDDQEAVLCFYKTAKDCVMMFTYSELPSGKSN*706LTVLREPECGTAPS AMTILLAVVGSILLTGFALLVIWKLLVTIHDRREFAKFQSERSRARYEMAS*771NPLYRKPIS THTVDFTFNKFNKSYNGTVD
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 1TMH; (721-743)
Bibliography Zhang LY, Guo Q, Guan GF, Cheng W, Cheng P, Wu AH. Integrin Beta 5 Is a Prognostic Biomarker and Potential Therapeutic Target in Glioblastoma. Front Oncol. 2019 Sep 20;9:904. doi: 10.3389/fonc.2019.00904. PMID: 31616629; PMCID: PMC6764112.