Search by BoMiProt ID - Bomi6427


Primary Information

BoMiProt ID Bomi6427
Protein Name Integrator complex subunit 7/Int7
Organism Bos taurus
Uniprot IdQ1RMS6
Milk Fractionwhey
Ref Sequence Id NP_001069512.1
Aminoacid Length 962
Molecular Weight 106771
Fasta Sequence https://www.uniprot.org/uniprot/Q1RMS6.fasta
Gene Name INTS7
Gene Id 534964
Protein Existence Status Reviewed

Secondary Information

Protein Function It is a component of the Integrator (INT) complex which is involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing.
Biochemical Properties The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1RMS6|INT7_BOVIN Integrator complex subunit 7 OS=Bos taurus OX=9913 GN=INTS7 PE=2 SV=1 MASNSTKSFLADAGYGEQELDANSALMELDKGLRSGKLGEQCEAVVRFPRLFQKYPFPIL INSAFLKLADVFRVGNNFLRLCVLKVTQQSEKHLEKILNVDEFVKRIFSVIHSNDPVARA ITLRMLGSLASIIPERKNAHHSIRQSLDSHDNVEVEAAVFAAANFSAQSKDFAVGICNKI SEMIQGLATPVDLKLKLIPILQHMHHDAILASSARQLLQQLVTAYPSTRMVIVSLHTFTL LAASSLVDTPKQIQLLLQYLKNDPRKAVKRLAIQDLKLLANKTPHTWSRENIQALCECAL QTPYDSLKLGMLSVLATLSGTIAVKHYFSIASGNVGSS*338PRSSDLVKLAQECCYHNNRGIA AHGVRVLTNITVSCQEKDLLALEQDAVFGLESLLVLCSQDDSPGAQATLKIALNCMVKLA KGRPHLSQSVVETLLTQLHSAQDTARILMCHCLAAIAMQLPVLGDGMLGDLVELYKVIGR SATDKQQELLVSLATVIFVASQKALSAEVKAVIKQQLESVSNGWTVYRIARQASRMGNHD MARELYQTLLTQVASEHFYFWLNSLKEFSHAEQCLTGLQEENYSSALSCIAESLKFYHKG IASLTAASTPLNPLSFQCEFVKLRIDLLQAFSQLICTCNSLKTSPPPAIATTIAMTLGND LQRCGRISNQMKLSMEEFRSLASRYGDLYQASFDADSATLRNVELQQQSCLLISHAIEAL ILDPESASFQEYGSTGAAHADSEYERRMMSVYNHVLEEVESLNRKYTPVSYMHTACLCNA IISLLKVPLSFQRYFFQKLQSTSIKLALS*809PSPRNPAEPIAVQNNQQLALKVEGVVQHGSK PGLFRRIQSVCLNVSSTLQSKSGQDYKIPIDNMTNEMEQRVEPHNDYFSTQFLLNFAILG THNITVESSVKDANGIVWKTGPRTTIFVKSLEDPYSQQIRLQQQQAQQPLQQQQQRNAYT RF
Predicted Disorder Regions 936-962
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Li, X., Yao, Y., Qian, J., Jin, G., Zeng, G., & Zhao, H. (2021). Overexpression and diagnostic significance of INTS7 in lung adenocarcinoma and its effects on tumor microenvironment. International immunopharmacology, 101(Pt B), 108346. https://doi.org/10.1016/j.intimp.2021.108346