Search by BoMiProt ID - Bomi6420


Primary Information

BoMiProt ID Bomi6420
Protein Name Integrator complex subunit 12/Int12/PHD finger protein 22
Organism Bos taurus
Uniprot IdQ32LL5
Milk FractionWhey
Ref Sequence Id NP_001069221.1
Aminoacid Length 462
Molecular Weight 48557
Fasta Sequence https://www.uniprot.org/uniprot/Q32LL5.fasta
Gene Name INTS12/PHF22
Gene Id 517489
Protein Existence Status Reviewed

Secondary Information

Protein Function Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32LL5|INT12_BOVIN Integrator complex subunit 12 OS=Bos taurus OX=9913 GN=INTS12 PE=2 SV=1 MAAAVNLELDPIFLKALGFLHSKSKDSAEKLKTLLDESLARGIDSSYRPSQKDVEPPKIS STKTVSVKQEPKTSSSLPSGNNNGKVLTTEKVKKEGEKRPADKMKSDITEGADVPKKPRL EKPETRSS*128PITVQTSKDLAMADLSSFEETSADDFAMEMGLACVVCRQMTVASGNQLVECQ ECHNLYHQDCHKPQVTDKEVTDPRLVWYCARCTRQMKRMAQKTQKPPQKPAPTVVSVAPA VKDPLVKKPETKLKPETTFLAFKRSEVKASTVVSGNSSSTNVSSSATSGLIGWAAFAAKT TSAGPSTAKLSSAAQNNSGKPATSSANQKPVGLTGLATTSKGGIGSKIGSSNSTSPTVPL KPPPPLTLGKTGLSRSVSCDNVSKVGLPSPSSLVPGSSSQLSGNGNSGTSGPSGSTTNKT ASEPSTSPSASLKGPTSQESQLNAMKRLQMVKKKAAQKKLKK
Predicted Disorder Regions 21-131, 148-154, 218-256, 269-358, 369-462
DisProt Annotation
TM Helix Prediction no TM helices
Bibliography Obeidat, M., Miller, S., Probert, K., Billington, C. K., Henry, A. P., Hodge, E., Nelson, C. P., Stewart, C. E., Swan, C., Wain, L. V., Soler Artigas, M., Melén, E., Ushey, K., Hao, K., Lamontagne, M., Bossé, Y., Postma, D. S., Tobin, M. D., Sayers, I., & Hall, I. P. (2013). GSTCD and INTS12 regulation and expression in the human lung. PloS one, 8(9), e74630. https://doi.org/10.1371/journal.pone.0074630