Primary Information |
|---|
| BoMiProt ID | Bomi6415 |
|---|
| Protein Name | Insulin-like growth factor-binding protein 5/
IBP-5//IGF-binding protein 5/IGFBP-5 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q05717 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001098797.1 |
|---|
| Aminoacid Length | 271 |
|---|
| Molecular Weight | 30314 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | IGFBP5 |
|---|
| Gene ID | 404185 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. |
|---|
| Significance in milk | Imp role mammary gland development, which facilitates the removal of mammary epithelial cells (MECs) by apoptosis that takes place during remodeling of the mammary gland during involution. |
|---|
| PTMs | Disulfide bond, Phosphoprotein |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q05717|IBP5_BOVIN Insulin-like growth factor-binding protein 5 OS=Bos taurus OX=9913 GN=IGFBP5 PE=2 SV=2
MVLTAVLLLLAACAGSAQGLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCAL
AEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQAKIERDS*115REHEE
PTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRVISAP
EMRQKSEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGIC
WCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
|
|---|
| Predicted Disorder Regions | 3 predicted disordered segments; (103-203), (226-235), (266-271) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | IGFBP-5 was shown to be upregulated in lung tissue from patients with idiopathic pulmonary fibrosis (IPF).IGFBP-5 is known to bind to ECM components PAI-1 and osteopontin, which have both been found in atherosclerotic plaques and have been shown to promote atherosclerosis in loss of function studies |
|---|
| Bibliography | Hansen JS, Plomgaard P. Circulating follistatin in relation to energy metabolism. Mol Cell Endocrinol. 2016 Sep 15;433:87-93. doi: 10.1016/j.mce.2016.06.002. Epub 2016 Jun 2. PMID: 27264073. |
|---|
