Search by BoMiProt ID - Bomi6402


Primary Information

BoMiProt ID Bomi6402
Protein Name Inosine-5'-monophosphate dehydrogenase 1/IMP dehydrogenase 1/ IMPD 1/IMPDH 1
Organism Bos taurus
Uniprot IdA0JNA3
Milk FractionWhey
Ref Sequence Id NP_001071309.1
Aminoacid Length 514
Molecular Weight 55424
Fasta Sequence https://www.uniprot.org/uniprot/A0JNA3.fasta
Gene Name IMPDH1
Gene Id 504305
Protein Existence Status reviewed

Secondary Information

Protein Function Inosine-5'-monophosphate dehydrogenase (IMPDH) catalyzes the conversion of inosine 5'-monophosphate (IMP) to xanthosine 5'-monophosphate (XMP)
Biochemical Properties Inosine monophosphate dehydrogenase (IMPDH) is a rate-limiting enzyme involved in purine nucleotide biosynthesis. It is responsible for catalyzing the oxidation of inosine monophosphate (IMP) into xanthosine monophosphate (XMP).
PTMs Methylation,Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A0JNA3|IMDH1_BOVIN Inosine-5'-monophosphate dehydrogenase 1 OS=Bos taurus OX=9913 GN=IMPDH1 PE=2 SV=2 MADYLISGGTGYVPEDGLTAQQLFANADGLTYNDFLILPGFIDFTADEVDLTSALTRKIT LKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVV LSPSHTVGDVLEAKIRHGFSGIPITETGTMGSKLVGIVTS*160RDIDFLAEKDHTTLLSEVMT PRNELVVAPAGVTLKEANEILQRSKKGKLPIVNDRDELVAIIARTDLKKNRDYPLASKDS HKQLLCGAAVGTREDDKYRLDLLTQAGADVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVI GGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVP VIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAM EKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLR SMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments  5F02, significantly inhibits IMPDH activity in a dose-dependent manner. 
Bibliography 1.Wei Y, Kuzmič P, Yu R, Modi G, Hedstrom L. Inhibition of Inosine-5'-monophosphate Dehydrogenase from Bacillus anthracis: Mechanism Revealed by Pre-Steady-State Kinetics. Biochemistry. 2016 Sep 20;55(37):5279-88. doi: 10.1021/acs.biochem.6b00265. Epub 2016 Sep 2. PMID: 27541177; PMCID: PMC5524190. 2.Anthony S, Peterson JR, Ji Y. Use of Inosine Monophosphate Dehydrogenase Activity Assay to Determine the Specificity of PARP-1 Inhibitors. Methods Mol Biol. 2017;1608:337-342. doi: 10.1007/978-1-4939-6993-7_22. PMID: 28695520.